KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100583216
Entry
100583216         CDS       T03265                                 

Gene name
DVL3
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-3
  KO
K02353  segment polarity protein dishevelled
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04330  Notch signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100583216 (DVL3)
   04330 Notch signaling pathway
    100583216 (DVL3)
   04390 Hippo signaling pathway
    100583216 (DVL3)
   04150 mTOR signaling pathway
    100583216 (DVL3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100583216 (DVL3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100583216 (DVL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100583216 (DVL3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100583216 (DVL3)
   05226 Gastric cancer
    100583216 (DVL3)
   05217 Basal cell carcinoma
    100583216 (DVL3)
   05224 Breast cancer
    100583216 (DVL3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100583216 (DVL3)
   05022 Pathways of neurodegeneration - multiple diseases
    100583216 (DVL3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100583216 (DVL3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100583216 (DVL3)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100583216
NCBI-ProteinID: XP_030678751
Ensembl: ENSNLEG00000006124
LinkDB
Position
11
AA seq 716 aa
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgggcgagaccaagatcatctaccacttggatgggcaggagacgccgtaccttgtgaag
ctgcccctgcctgccgagcgcgtcaccttggcggactttaagggcgttttgcagcgaccc
agctataagttcttcttcaagtctatggacgacgatttcggagtggtgaaggaggagatc
tcggatgacaatgccaagctaccgtgcttcaatggccgggtggtgtcctggctggtgtca
gctgagggctcacacccagacccagcccccttctgtgctgacaacccatcggagctgcca
ccacctatggagcgcacgggaggcatcggggactcccgacccccatccttccaccctcat
gctggtgggggcagccaggagaacctggacaatgacacagagacggactctttggtgtct
gcccagcgagagcggccacgccggagggatggcccagagcatgcaacccggctaaatgga
actgcgaagggggagcggcggcgagaaccagggggttatgatagctcatccacccttatg
agcagcgagctggagaccaccagcttctttgactcagatgaggatgactccaccagcagg
ttcagcagctccacagaacagagcagcgcctcacgcctgatgagaagacacaagcggcgg
cggcggaagcagaaggtttctcggattgagcggtcctcgtccttcagcagcatcacggac
tccaccatgtcactcaacatcatcacggtcactctcaacatggagaaatataacttcttg
ggcatctccatcgtgggccaaagcaacgagcgtggtgacggcggcatctacattggctct
atcatgaagggtggagccgtggctgctgatggacgcatcgagccaggagatatgctgtta
caggtaaacgagatcaactttgagaacatgagtaatgacgatgcagtccgggtactgcgg
gagattgtgcacaaaccggggcccatcaccctgactgtagccaagtgctgggacccaagt
ccacgtggttgcttcacattgcccaggagcgagcccatccggcccattgaccctgcggcc
tgggtctcccacactgcagccatgaccggcaccttccctgcatacggcatgagcccctcc
ctgagcaccatcacctccaccagctcctccatcaccagttccatccctgacacagagcgc
ctagacgacttccacttgtccatccacagtgacatggctgccatcgtaaaagccatggcc
tcccctgaatcagggttggaggtccgtgaccgcatgtggctcaagattaccatccctaat
gctttcatcggctcagatgtggtggactggctgtaccacaatgtggaaggcttcacggac
cggagggaggcccgcaagtatgccagcaacctgctgaaagctggcttcatccgccatacc
gtcaacaagatcaccttctccgagcagtgctactacatcttcggcgacctctgcggcaac
atggccaacctgtctctccacgatcacgatggctccagtggcgcttctgaccaggacaca
ctggcccctttgccgcacccgggggccgccccttggcccatggctttcccgtaccagtac
ccgccacccccgcacccctacaacccccacccgggcttcccggagctgggctacagctac
ggcgggggcagcgccagcagtcagcacagcgaaggcagtcggagcagtggctccaaccgt
agcggcagcgatcggaggaaggagaaggacccgaaggccggggactccaagtctgggggc
agcggcagcgaatcggaccacaccacacgcagcagcctgcgggggccgcgggagcgggcg
cccagcgagcgctcagggccagcggccagcgagcacagccaccgcagccaccattccctg
gccagcagccttcgcagccaccacacccacccaagctacggccctcccggagtgccccct
ctctacggcccccccatgctgatgatgcccccgccgcccgcggccatggggcccccagga
gcccctccgggccgcgacctggcctcagtgcccccggaactgaccgccagcagacaatcc
ttccgcatggccatgggaaaccccagtgagttctttgtggatgtgatgtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585595
Entry
100585595         CDS       T03265                                 

Gene name
DVL2
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-2
  KO
K02353  segment polarity protein dishevelled
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04330  Notch signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100585595 (DVL2)
   04330 Notch signaling pathway
    100585595 (DVL2)
   04390 Hippo signaling pathway
    100585595 (DVL2)
   04150 mTOR signaling pathway
    100585595 (DVL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100585595 (DVL2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100585595 (DVL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100585595 (DVL2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100585595 (DVL2)
   05226 Gastric cancer
    100585595 (DVL2)
   05217 Basal cell carcinoma
    100585595 (DVL2)
   05224 Breast cancer
    100585595 (DVL2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100585595 (DVL2)
   05022 Pathways of neurodegeneration - multiple diseases
    100585595 (DVL2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100585595 (DVL2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100585595 (DVL2)
SSDB
Motif
Pfam: Dsh_C Dishevelled DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100585595
NCBI-ProteinID: XP_004092705
Ensembl: ENSNLEG00000008027
LinkDB
Position
19
AA seq 736 aa
MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMAPPAHEPRAELAPPAPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRERPRRRDSSEHGAGGHRTG
GPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRLERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMSTITSGSSLPDGCEGRGLSIH
TDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEPSGTSDGGPPPSRGSTGGAANLRA
HPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
NT seq 2211 nt   +upstreamnt  +downstreamnt
atggcgggcagcagcactgggggcggtggggttggggagacgaaggtgatttaccatctg
gatgaggaagagactccctacctggtgaagatccctgtccccgccgagcgcatcaccctc
ggcgatttcaagagcgtcctgcagcggcccgcaggcgccaagtactttttcaagtctatg
gatcaggatttcggggtggtgaaggaagaaatttcagatgacaacgcccgcctcccctgc
ttcaacggaagggtggtatcctggctggtgtcctcagataatccccaacccgagatggcc
cctccagcccatgagcctcgggcagaactggcgcctccagccccacctttaccccctttg
ccacccgagaggaccagcggcattggggactcaaggcctccatccttccaccctaatgtg
tccagcagccatgagaatctggagcctgagacagaaaccgagtcagtagtgtcactgagg
cgggagcggcctcgcaggagagacagcagtgagcatggcgctgggggccacaggactggt
ggcccctcaaggctggagcgccacctggccggatacgagagctcctctaccctcatgacc
agcgagctggagagtaccagcctgggggactcagatgaggaggacaccatgagcaggttc
agcagctccacggagcagagcagtgcctcccgcctccttaagcgccaccggcggcgaagg
aagcagcggccaccccgcctggagaggacgtcgtccttcagcagcgtcacagattccaca
atgtctctgaatatcatcacagtcacgctaaacatggagaagtacaacttcctgggtatc
tccatcgtgggccaaagcaacgagcggggagacggaggcatctacattggctccatcatg
aagggtggggctgtggcggccgacgggcgcattgagccaggggacatgcttttgcaggtg
aatgacatgaactttgagaacatgagcaatgatgacgccgtgcgggtgctgagggacatt
gtgcacaagcctggccccattgtgctgactgtggccaagtgctgggatccctctcctcag
gcctatttcactctcccccgaaatgagcccatccagccaattgaccctgctgcctgggtg
tcccattccgcggctctgactggcaccttcccagcctatccaggctcctcgtccatgagc
accattacatctggatcgtctttgcctgatggctgtgagggccggggtctctccatccat
acggacatggcatcggtgaccaaggccatggcagctccagagtctggactggaagtccgg
gaccgcatgtggctcaagatcaccatccctaatgcctttctgggctcggatgtggttgac
tggctctaccatcacgtggagggctttcctgagcggcgggaggcccgcaaatatgccagc
gggctgctcaaagcgggtctgatccgacacaccgtcaacaagatcaccttctctgagcag
tgctattacgtcttcggagacctcagtggtggctgtgagagctacctagtcaacctgtct
ctcaatgacaacgatggctccagtggggcctcagaccaggataccctggctcctttgcct
ggggccaccccttggcccctgctgcccactttctcctaccaataccctgccccacacccc
tacagcccgcagcctccaccctaccatgagctttcatcttacacctatggtgggggcagt
gccagcagccagcacagtgagggcagccggagcagtgggtcgacacggagtgacgggggg
gcagggcgcacggggaggcccgaagagcgggcccccgagtccaagtctggtagtggcagt
gagtccgagccctccagccgagggggcagccttcggcggggtggggaaccaagtgggact
agcgatgggggccctcctccatccagaggctcaactgggggtgccgctaatctccgagcc
cacccagggctccatccctatggaccgccccctggcatggccctcccctacaaccccatg
atggtggtcatgatgcccccacctccacctccagtccctccagcagtgcagcctccgggg
gcccctccagtcagagacctgggctctgtgcccccagaactgacagccagccgccaaagc
ttccacatggccatgggcaatcccagcgagttctttgtggatgttatgtag

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593186
Entry
100593186         CDS       T03265                                 

Gene name
DVL1
Definition
(RefSeq) segment polarity protein dishevelled homolog DVL-1 isoform X1
  KO
K02353  segment polarity protein dishevelled
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04150  mTOR signaling pathway
nle04310  Wnt signaling pathway
nle04330  Notch signaling pathway
nle04390  Hippo signaling pathway
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100593186 (DVL1)
   04330 Notch signaling pathway
    100593186 (DVL1)
   04390 Hippo signaling pathway
    100593186 (DVL1)
   04150 mTOR signaling pathway
    100593186 (DVL1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100593186 (DVL1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100593186 (DVL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593186 (DVL1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100593186 (DVL1)
   05226 Gastric cancer
    100593186 (DVL1)
   05217 Basal cell carcinoma
    100593186 (DVL1)
   05224 Breast cancer
    100593186 (DVL1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100593186 (DVL1)
   05022 Pathways of neurodegeneration - multiple diseases
    100593186 (DVL1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100593186 (DVL1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100593186 (DVL1)
SSDB
Motif
Pfam: Dishevelled Dsh_C DIX PDZ DEP PDZ_6 Shufflon_N
Other DBs
NCBI-GeneID: 100593186
NCBI-ProteinID: XP_030661777
Ensembl: ENSNLEG00000000028
LinkDB
Position
24
AA seq 695 aa
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDVGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNREEAARTNGHPRGDRRRDVGLPPDSAST
ALSSELESSSFVDSDEDGSTSRLSSSTEQSTSSRLIRKHKRRRRKQRLRQTDRASSFSSI
TDSTMSLNIVTVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTVPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAVTRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAVVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLATLNLNSGSSGASDQDTLAPLPHPAAPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGS
GSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPMTKAYTVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
NT seq 2088 nt   +upstreamnt  +downstreamnt
atggcggagaccaagatcatctaccacatggacgaggaggagacgccgtacctggtcaag
ctgcccgtggcccccgagcgcgtcacgctagccgacttcaagaacgtgctcagcaaccgg
cccgtgcacgcctacaaattcttctttaagtccatggaccaggacttcggggtggtgaag
gaggagatctttgatgacaacgccaagcttccctgcttcaacggccgcgtggtctcctgg
ctggtcctggctgagggtgctcactcagatgtggggtcccagggcacggacagccacaca
gacctgcccccgcctctcgagcggacaggcggcatcggagactcccggcccccctccttc
cacccgaatgtggccagcagccgtgacgggatggacaatgagacaggcacggagtccatg
gtcagccaccggcgggagcgtgcccgacgccggaaccgcgaggaggccgcccggaccaat
gggcacccaaggggagaccgacggcgggatgtagggctgcccccagacagtgcgtccacc
gccctgagcagcgagcttgaatccagcagctttgtggactcggacgaggatggcagcaca
agcaggctgagcagctccacggagcagagcacctcatccaggctcatccggaagcacaaa
cgccggcggaggaagcagcgccttcggcagacggaccgggcctcctccttcagcagcata
accgactccaccatgtctctcaacatcgtcactgtcacgctcaacatggagagacatcac
tttctgggcatcagcatcgtggggcagagcaacgaccgtggagacggcggcatctacatc
ggctccatcatgaagggcggggctgtggccgctgacggccgcatcgagcccggcgacatg
ttgctgcaggtgaatgacgtgaactttgagaatatgagcaacgatgacgctgtgcgggtg
ctgcgggagatcgtgtcccagacggggcccatcagcctcactgtggccaagtgctgggac
ccgacgccccgaagctacttcaccgtcccacgggctgacccggtgcggcccatcgacccc
gccgcctggctgtcccacacggcggcactgacaggagccctgccccgctacggtacgagc
ccctgctccagcgccgtcacgcgcaccagctcctcctcactaaccagctccgtgcctggt
gctccacagctggaagaggcgccgctgacggtgaagagtgacatgagcgccgtggtccgg
gtcatgcagctgccagactcgggactggagatccgcgaccgtatgtggctcaagatcacc
attgccaacgctgtcatcggggcggacgtggtggactggctgtacacacacgtggaaggc
ttcaaggagcggcgggaggcccggaagtacgccagcagcttgctgaaacacggctttctg
cggcacacggtcaacaagatcaccttctccgagcagtgctactacgtattcggggacctc
tgcagcaatctcgccaccctgaacctcaacagtggctccagtggggcttcggatcaggac
acgctggccccgctgccccacccggctgccccctggcccctgggtcagggctacccctac
cagtacccggggcccccgccctgcttcccgcctgcctaccaggacccaggctttagctat
ggcagtggcagcaccgggagtcagcagagtgaagggagcaagagcagcgggtccacccgg
agcagccgccgggccccgggccgtgagaaggagcgtcgggcggcgggagccgggggcagt
ggcagtgaatcggatcacacggcaccgagtggggtggggagcagctggcgagagcgtccg
gctggccagctcagccgcggcagcagcccacgcagtcaggcctcggccaccgccccgggg
ctccccccgccccaccccatgaccaaggcctatacggtggtgggggggccccccggggga
ccccctgtccgggagctggctgccgtccccccggagttgacaggcagtcgccagtccttt
cagaaggctatggggaacccctgtgagttcttcgtggacatcatgtga

DBGET integrated database retrieval system