KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100585771Help
Entry
100585771         CDS       T03265                                 

Gene name
HTR7
Definition
(RefSeq) 5-hydroxytryptamine receptor 7 isoform X1
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04014  Ras signaling pathway
nle04020  Calcium signaling pathway
nle04080  Neuroactive ligand-receptor interaction
nle04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100585771 (HTR7)
   04020 Calcium signaling pathway
    100585771 (HTR7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100585771 (HTR7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    100585771 (HTR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:nle04030]
    100585771 (HTR7)
G protein-coupled receptors [BR:nle04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    100585771 (HTR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100585771
NCBI-ProteinID: XP_030658406
Ensembl: ENSNLEG00000012379
LinkDB All DBs
Position
3
AA seq 492 aa AA seqDB search
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRAEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPGKMPRVSVWVLQSPDHHNWLADKMLTTVEKKVMIHDR
KQNNGDEINTAK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgcccggacctctacgggcacctccgctctttcctt
ctgccagaagtggggcgcgggctgcccgacctgagccccgacggtggcgccgacccggtc
gcgggctcctgggcgccgcacctgctgagcgaggtgacagccagcccggcgcccacctgg
gacgcgcccccggacaatgcctccggctgtggggaacagatcaactacggcagagccgag
aaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcgggcaactgc
ctggtggtgatctccgtgtgcttcgtcaagaagctccgccagccttccaactacctgatc
gtgtccctggcgctggccgacctctcggtggctgtggcggtcatgcccttcgtcagcgtc
accgacctcatcgggggcaagtggatctttggccactttttctgtaatgtcttcatcgcc
atggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgataagcattgacagg
taccttgggatcacaaggcccctcacgtaccctgtgaggcagaatgggaaatgcatggcg
aagatgattctctccgtctggcttctctccgcctccatcactttacctccactctttgga
tgggctcagaatgtaaatgatgataaggtgtgcttgatcagccaggactttggctatacg
atttactctaccgcagtggcattttatatccccatgtccgtcatgcttttcatgtactac
cagatttacaaggctgccaggaagagtgctgccaaacacaagttccctggcttccctcga
gtggagccagacagcgtcatcgccctgaatggcatagtgaagctccagaaggaggtggaa
gagtgtgcaaacctttcgagactcctcaagcatgaaaggaaaaacatctccatctttaag
cgggaacagaaagcagccaccacactggggatcatcgtcggggcctttaccgtgtgctgg
ctgccgtttttcctcctctcgacagccagacccttcatctgtggcacttcctgcagctgc
atcccactgtgggtggagaggacatttctgtggctaggctatgcaaactctctcattaac
ccttttatatatgccttcttcaaccgggacctgaggaccacctatcgcagcctgctccag
tgccagtaccggaatatcaaccggaagctctcggctgcaggcatgcatgaagccctgaag
cttgctgagaggccagagagacctgagtttgtgctgagggcctgcacaaggagggtgctg
ttgagaccaggaaagatgccgcgggtgtctgtgtgggtgctacaatctccagaccatcac
aattggttagcagacaaaatgctgactactgtagaaaaaaaggtcatgattcatgatcga
aagcagaacaatggagatgaaataaacacggcaaaatag

DBGET integrated database retrieval system