KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587109
Entry
100587109         CDS       T03265                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04261  Adrenergic signaling in cardiomyocytes
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04728  Dopaminergic synapse
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04920  Adipocytokine signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100587109 (AKT1)
   04012 ErbB signaling pathway
    100587109 (AKT1)
   04014 Ras signaling pathway
    100587109 (AKT1)
   04015 Rap1 signaling pathway
    100587109 (AKT1)
   04370 VEGF signaling pathway
    100587109 (AKT1)
   04371 Apelin signaling pathway
    100587109 (AKT1)
   04630 JAK-STAT signaling pathway
    100587109 (AKT1)
   04668 TNF signaling pathway
    100587109 (AKT1)
   04066 HIF-1 signaling pathway
    100587109 (AKT1)
   04068 FoxO signaling pathway
    100587109 (AKT1)
   04072 Phospholipase D signaling pathway
    100587109 (AKT1)
   04071 Sphingolipid signaling pathway
    100587109 (AKT1)
   04024 cAMP signaling pathway
    100587109 (AKT1)
   04022 cGMP-PKG signaling pathway
    100587109 (AKT1)
   04151 PI3K-Akt signaling pathway
    100587109 (AKT1)
   04152 AMPK signaling pathway
    100587109 (AKT1)
   04150 mTOR signaling pathway
    100587109 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100587109 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100587109 (AKT1)
   04218 Cellular senescence
    100587109 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100587109 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100587109 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100587109 (AKT1)
   04613 Neutrophil extracellular trap formation
    100587109 (AKT1)
   04620 Toll-like receptor signaling pathway
    100587109 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100587109 (AKT1)
   04660 T cell receptor signaling pathway
    100587109 (AKT1)
   04662 B cell receptor signaling pathway
    100587109 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100587109 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100587109 (AKT1)
   04062 Chemokine signaling pathway
    100587109 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100587109 (AKT1)
   04922 Glucagon signaling pathway
    100587109 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100587109 (AKT1)
   04920 Adipocytokine signaling pathway
    100587109 (AKT1)
   04929 GnRH secretion
    100587109 (AKT1)
   04915 Estrogen signaling pathway
    100587109 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100587109 (AKT1)
   04917 Prolactin signaling pathway
    100587109 (AKT1)
   04926 Relaxin signaling pathway
    100587109 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100587109 (AKT1)
   04919 Thyroid hormone signaling pathway
    100587109 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100587109 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100587109 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100587109 (AKT1)
   04728 Dopaminergic synapse
    100587109 (AKT1)
   04722 Neurotrophin signaling pathway
    100587109 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100587109 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100587109 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100587109 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587109 (AKT1)
   05205 Proteoglycans in cancer
    100587109 (AKT1)
   05230 Central carbon metabolism in cancer
    100587109 (AKT1)
   05231 Choline metabolism in cancer
    100587109 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100587109 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100587109 (AKT1)
   05212 Pancreatic cancer
    100587109 (AKT1)
   05225 Hepatocellular carcinoma
    100587109 (AKT1)
   05226 Gastric cancer
    100587109 (AKT1)
   05214 Glioma
    100587109 (AKT1)
   05221 Acute myeloid leukemia
    100587109 (AKT1)
   05220 Chronic myeloid leukemia
    100587109 (AKT1)
   05218 Melanoma
    100587109 (AKT1)
   05211 Renal cell carcinoma
    100587109 (AKT1)
   05215 Prostate cancer
    100587109 (AKT1)
   05213 Endometrial cancer
    100587109 (AKT1)
   05224 Breast cancer
    100587109 (AKT1)
   05222 Small cell lung cancer
    100587109 (AKT1)
   05223 Non-small cell lung cancer
    100587109 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100587109 (AKT1)
   05017 Spinocerebellar ataxia
    100587109 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100587109 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100587109 (AKT1)
   04931 Insulin resistance
    100587109 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100587109 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100587109 (AKT1)
   05135 Yersinia infection
    100587109 (AKT1)
   05152 Tuberculosis
    100587109 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100587109 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100587109 (AKT1)
   05161 Hepatitis B
    100587109 (AKT1)
   05160 Hepatitis C
    100587109 (AKT1)
   05164 Influenza A
    100587109 (AKT1)
   05162 Measles
    100587109 (AKT1)
   05168 Herpes simplex virus 1 infection
    100587109 (AKT1)
   05163 Human cytomegalovirus infection
    100587109 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100587109 (AKT1)
   05169 Epstein-Barr virus infection
    100587109 (AKT1)
   05165 Human papillomavirus infection
    100587109 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100587109 (AKT1)
   05142 Chagas disease
    100587109 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100587109 (AKT1)
   01524 Platinum drug resistance
    100587109 (AKT1)
   01522 Endocrine resistance
    100587109 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100587109 (AKT1)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100587109 (AKT1)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100587109 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100587109
NCBI-ProteinID: XP_030659553
Ensembl: ENSNLEG00000016343
LinkDB
Position
22a
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggacgtggaccagcgtgaggcccccctcaacaacttctctgtggcacagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcatcgaacgcaccttccacgtggagactcccgaggagcgggaggagtggaca
actgccatccagacggtggccgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagcgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgtgtgaccatgaacgagtttgagtacctgaaactgctgggcaagggcact
ttcgggaaggtgatcctggtgaaggagaaggccacaggccgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaagtggcccacacactcaccgagaaccgc
gtcctgcagaactccaggcaccccttcctcacggccctgaagtactctttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctccgaggaccgggcccgcttctatggcgctgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggatgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggacggggccaccatgaagaccttttgcggcacacccgagtacctggcccccgaggtg
ctggaggacaatgactacggccgtgcagtggactggtgggggctgggtgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatacgcttcccgcgcacacttggtcctgaggccaagtccttgctc
tcggggctgctcaagaaggaccccaagcagaggcttggcgggggctccgaggacgccaag
gagatcatgcagcatcgcttctttgccggcatcgtgtggcagcacgtgtacgagaagaag
ctcagcccacccttcaagccccaggtcacgtcggagaccgacaccaggtattttgatgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100587864
Entry
100587864         CDS       T03265                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04261  Adrenergic signaling in cardiomyocytes
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04728  Dopaminergic synapse
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04920  Adipocytokine signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100587864 (AKT2)
   04012 ErbB signaling pathway
    100587864 (AKT2)
   04014 Ras signaling pathway
    100587864 (AKT2)
   04015 Rap1 signaling pathway
    100587864 (AKT2)
   04370 VEGF signaling pathway
    100587864 (AKT2)
   04371 Apelin signaling pathway
    100587864 (AKT2)
   04630 JAK-STAT signaling pathway
    100587864 (AKT2)
   04668 TNF signaling pathway
    100587864 (AKT2)
   04066 HIF-1 signaling pathway
    100587864 (AKT2)
   04068 FoxO signaling pathway
    100587864 (AKT2)
   04072 Phospholipase D signaling pathway
    100587864 (AKT2)
   04071 Sphingolipid signaling pathway
    100587864 (AKT2)
   04024 cAMP signaling pathway
    100587864 (AKT2)
   04022 cGMP-PKG signaling pathway
    100587864 (AKT2)
   04151 PI3K-Akt signaling pathway
    100587864 (AKT2)
   04152 AMPK signaling pathway
    100587864 (AKT2)
   04150 mTOR signaling pathway
    100587864 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100587864 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100587864 (AKT2)
   04218 Cellular senescence
    100587864 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100587864 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100587864 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100587864 (AKT2)
   04613 Neutrophil extracellular trap formation
    100587864 (AKT2)
   04620 Toll-like receptor signaling pathway
    100587864 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100587864 (AKT2)
   04660 T cell receptor signaling pathway
    100587864 (AKT2)
   04662 B cell receptor signaling pathway
    100587864 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100587864 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100587864 (AKT2)
   04062 Chemokine signaling pathway
    100587864 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100587864 (AKT2)
   04922 Glucagon signaling pathway
    100587864 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100587864 (AKT2)
   04920 Adipocytokine signaling pathway
    100587864 (AKT2)
   04929 GnRH secretion
    100587864 (AKT2)
   04915 Estrogen signaling pathway
    100587864 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100587864 (AKT2)
   04917 Prolactin signaling pathway
    100587864 (AKT2)
   04926 Relaxin signaling pathway
    100587864 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100587864 (AKT2)
   04919 Thyroid hormone signaling pathway
    100587864 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100587864 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100587864 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100587864 (AKT2)
   04728 Dopaminergic synapse
    100587864 (AKT2)
   04722 Neurotrophin signaling pathway
    100587864 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100587864 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100587864 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100587864 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100587864 (AKT2)
   05205 Proteoglycans in cancer
    100587864 (AKT2)
   05230 Central carbon metabolism in cancer
    100587864 (AKT2)
   05231 Choline metabolism in cancer
    100587864 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100587864 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100587864 (AKT2)
   05212 Pancreatic cancer
    100587864 (AKT2)
   05225 Hepatocellular carcinoma
    100587864 (AKT2)
   05226 Gastric cancer
    100587864 (AKT2)
   05214 Glioma
    100587864 (AKT2)
   05221 Acute myeloid leukemia
    100587864 (AKT2)
   05220 Chronic myeloid leukemia
    100587864 (AKT2)
   05218 Melanoma
    100587864 (AKT2)
   05211 Renal cell carcinoma
    100587864 (AKT2)
   05215 Prostate cancer
    100587864 (AKT2)
   05213 Endometrial cancer
    100587864 (AKT2)
   05224 Breast cancer
    100587864 (AKT2)
   05222 Small cell lung cancer
    100587864 (AKT2)
   05223 Non-small cell lung cancer
    100587864 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100587864 (AKT2)
   05017 Spinocerebellar ataxia
    100587864 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100587864 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100587864 (AKT2)
   04931 Insulin resistance
    100587864 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100587864 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100587864 (AKT2)
   05135 Yersinia infection
    100587864 (AKT2)
   05152 Tuberculosis
    100587864 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100587864 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100587864 (AKT2)
   05161 Hepatitis B
    100587864 (AKT2)
   05160 Hepatitis C
    100587864 (AKT2)
   05164 Influenza A
    100587864 (AKT2)
   05162 Measles
    100587864 (AKT2)
   05168 Herpes simplex virus 1 infection
    100587864 (AKT2)
   05163 Human cytomegalovirus infection
    100587864 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100587864 (AKT2)
   05169 Epstein-Barr virus infection
    100587864 (AKT2)
   05165 Human papillomavirus infection
    100587864 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100587864 (AKT2)
   05142 Chagas disease
    100587864 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100587864 (AKT2)
   01524 Platinum drug resistance
    100587864 (AKT2)
   01522 Endocrine resistance
    100587864 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100587864 (AKT2)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100587864 (AKT2)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100587864 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100587864
NCBI-ProteinID: XP_030651518
LinkDB
Position
17
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSVAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattgggtacaaggag
aggcccgaggcccctgatcagaccctaccccccttaaacaacttctctgtagcagaatgc
cagctgatgaagaccgagaggccgcgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagatgagagggaggagtggatg
cgggccatccagatggtcgctaacagcctcaagcagcgggccccaggcgaggaccccatg
gactacaagtgtggctcccccagtgactcctccgtggctgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggacgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccacgaccgcctgtgcttcgtgatggagtacgccaacgggggtgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc
tcggctcttgagtacttgcactcgcgggatgtggtataccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagtgatggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggcgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccctgaggccaagtccctg
cttgccgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcc
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggatgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggttgacacaaggtacttcgat
gatgaattcaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100604331
Entry
100604331         CDS       T03265                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04022  cGMP-PKG signaling pathway
nle04024  cAMP signaling pathway
nle04062  Chemokine signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04261  Adrenergic signaling in cardiomyocytes
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04380  Osteoclast differentiation
nle04510  Focal adhesion
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04611  Platelet activation
nle04613  Neutrophil extracellular trap formation
nle04620  Toll-like receptor signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04666  Fc gamma R-mediated phagocytosis
nle04668  TNF signaling pathway
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04728  Dopaminergic synapse
nle04910  Insulin signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04920  Adipocytokine signaling pathway
nle04922  Glucagon signaling pathway
nle04923  Regulation of lipolysis in adipocytes
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04931  Insulin resistance
nle04932  Non-alcoholic fatty liver disease
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04973  Carbohydrate digestion and absorption
nle05010  Alzheimer disease
nle05017  Spinocerebellar ataxia
nle05132  Salmonella infection
nle05135  Yersinia infection
nle05142  Chagas disease
nle05145  Toxoplasmosis
nle05152  Tuberculosis
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05162  Measles
nle05163  Human cytomegalovirus infection
nle05164  Influenza A
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05168  Herpes simplex virus 1 infection
nle05169  Epstein-Barr virus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100604331 (AKT3)
   04012 ErbB signaling pathway
    100604331 (AKT3)
   04014 Ras signaling pathway
    100604331 (AKT3)
   04015 Rap1 signaling pathway
    100604331 (AKT3)
   04370 VEGF signaling pathway
    100604331 (AKT3)
   04371 Apelin signaling pathway
    100604331 (AKT3)
   04630 JAK-STAT signaling pathway
    100604331 (AKT3)
   04668 TNF signaling pathway
    100604331 (AKT3)
   04066 HIF-1 signaling pathway
    100604331 (AKT3)
   04068 FoxO signaling pathway
    100604331 (AKT3)
   04072 Phospholipase D signaling pathway
    100604331 (AKT3)
   04071 Sphingolipid signaling pathway
    100604331 (AKT3)
   04024 cAMP signaling pathway
    100604331 (AKT3)
   04022 cGMP-PKG signaling pathway
    100604331 (AKT3)
   04151 PI3K-Akt signaling pathway
    100604331 (AKT3)
   04152 AMPK signaling pathway
    100604331 (AKT3)
   04150 mTOR signaling pathway
    100604331 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100604331 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100604331 (AKT3)
   04218 Cellular senescence
    100604331 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100604331 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100604331 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100604331 (AKT3)
   04613 Neutrophil extracellular trap formation
    100604331 (AKT3)
   04620 Toll-like receptor signaling pathway
    100604331 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100604331 (AKT3)
   04660 T cell receptor signaling pathway
    100604331 (AKT3)
   04662 B cell receptor signaling pathway
    100604331 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100604331 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100604331 (AKT3)
   04062 Chemokine signaling pathway
    100604331 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100604331 (AKT3)
   04922 Glucagon signaling pathway
    100604331 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100604331 (AKT3)
   04920 Adipocytokine signaling pathway
    100604331 (AKT3)
   04929 GnRH secretion
    100604331 (AKT3)
   04915 Estrogen signaling pathway
    100604331 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100604331 (AKT3)
   04917 Prolactin signaling pathway
    100604331 (AKT3)
   04926 Relaxin signaling pathway
    100604331 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100604331 (AKT3)
   04919 Thyroid hormone signaling pathway
    100604331 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100604331 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100604331 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100604331 (AKT3)
   04728 Dopaminergic synapse
    100604331 (AKT3)
   04722 Neurotrophin signaling pathway
    100604331 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100604331 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100604331 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100604331 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100604331 (AKT3)
   05205 Proteoglycans in cancer
    100604331 (AKT3)
   05230 Central carbon metabolism in cancer
    100604331 (AKT3)
   05231 Choline metabolism in cancer
    100604331 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100604331 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100604331 (AKT3)
   05212 Pancreatic cancer
    100604331 (AKT3)
   05225 Hepatocellular carcinoma
    100604331 (AKT3)
   05226 Gastric cancer
    100604331 (AKT3)
   05214 Glioma
    100604331 (AKT3)
   05221 Acute myeloid leukemia
    100604331 (AKT3)
   05220 Chronic myeloid leukemia
    100604331 (AKT3)
   05218 Melanoma
    100604331 (AKT3)
   05211 Renal cell carcinoma
    100604331 (AKT3)
   05215 Prostate cancer
    100604331 (AKT3)
   05213 Endometrial cancer
    100604331 (AKT3)
   05224 Breast cancer
    100604331 (AKT3)
   05222 Small cell lung cancer
    100604331 (AKT3)
   05223 Non-small cell lung cancer
    100604331 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100604331 (AKT3)
   05017 Spinocerebellar ataxia
    100604331 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100604331 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100604331 (AKT3)
   04931 Insulin resistance
    100604331 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100604331 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100604331 (AKT3)
   05135 Yersinia infection
    100604331 (AKT3)
   05152 Tuberculosis
    100604331 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100604331 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100604331 (AKT3)
   05161 Hepatitis B
    100604331 (AKT3)
   05160 Hepatitis C
    100604331 (AKT3)
   05164 Influenza A
    100604331 (AKT3)
   05162 Measles
    100604331 (AKT3)
   05168 Herpes simplex virus 1 infection
    100604331 (AKT3)
   05163 Human cytomegalovirus infection
    100604331 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100604331 (AKT3)
   05169 Epstein-Barr virus infection
    100604331 (AKT3)
   05165 Human papillomavirus infection
    100604331 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100604331 (AKT3)
   05142 Chagas disease
    100604331 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100604331 (AKT3)
   01524 Platinum drug resistance
    100604331 (AKT3)
   01522 Endocrine resistance
    100604331 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100604331 (AKT3)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100604331 (AKT3)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100604331 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100604331
NCBI-ProteinID: XP_030668449
Ensembl: ENSNLEG00000003927
LinkDB
Position
5
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccaatggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagcggaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggat
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttcaggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

DBGET integrated database retrieval system