KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590165
Entry
100590165         CDS       T03265                                 

Gene name
SOS1
Definition
(RefSeq) son of sevenless homolog 1 isoform X1
  KO
K03099  son of sevenless
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04072  Phospholipase D signaling pathway
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04722  Neurotrophin signaling pathway
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04926  Relaxin signaling pathway
nle04935  Growth hormone synthesis, secretion and action
nle05034  Alcoholism
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100590165 (SOS1)
   04012 ErbB signaling pathway
    100590165 (SOS1)
   04014 Ras signaling pathway
    100590165 (SOS1)
   04630 JAK-STAT signaling pathway
    100590165 (SOS1)
   04068 FoxO signaling pathway
    100590165 (SOS1)
   04072 Phospholipase D signaling pathway
    100590165 (SOS1)
   04151 PI3K-Akt signaling pathway
    100590165 (SOS1)
   04150 mTOR signaling pathway
    100590165 (SOS1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100590165 (SOS1)
   04540 Gap junction
    100590165 (SOS1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100590165 (SOS1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100590165 (SOS1)
   04660 T cell receptor signaling pathway
    100590165 (SOS1)
   04662 B cell receptor signaling pathway
    100590165 (SOS1)
   04664 Fc epsilon RI signaling pathway
    100590165 (SOS1)
   04062 Chemokine signaling pathway
    100590165 (SOS1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100590165 (SOS1)
   04912 GnRH signaling pathway
    100590165 (SOS1)
   04915 Estrogen signaling pathway
    100590165 (SOS1)
   04917 Prolactin signaling pathway
    100590165 (SOS1)
   04926 Relaxin signaling pathway
    100590165 (SOS1)
   04935 Growth hormone synthesis, secretion and action
    100590165 (SOS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100590165 (SOS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100590165 (SOS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100590165 (SOS1)
   05206 MicroRNAs in cancer
    100590165 (SOS1)
   05205 Proteoglycans in cancer
    100590165 (SOS1)
   05231 Choline metabolism in cancer
    100590165 (SOS1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100590165 (SOS1)
   05225 Hepatocellular carcinoma
    100590165 (SOS1)
   05226 Gastric cancer
    100590165 (SOS1)
   05214 Glioma
    100590165 (SOS1)
   05221 Acute myeloid leukemia
    100590165 (SOS1)
   05220 Chronic myeloid leukemia
    100590165 (SOS1)
   05211 Renal cell carcinoma
    100590165 (SOS1)
   05215 Prostate cancer
    100590165 (SOS1)
   05213 Endometrial cancer
    100590165 (SOS1)
   05224 Breast cancer
    100590165 (SOS1)
   05223 Non-small cell lung cancer
    100590165 (SOS1)
  09165 Substance dependence
   05034 Alcoholism
    100590165 (SOS1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100590165 (SOS1)
   05160 Hepatitis C
    100590165 (SOS1)
   05163 Human cytomegalovirus infection
    100590165 (SOS1)
   05165 Human papillomavirus infection
    100590165 (SOS1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100590165 (SOS1)
   01522 Endocrine resistance
    100590165 (SOS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:nle04990]
    100590165 (SOS1)
Domain-containing proteins not elsewhere classified [BR:nle04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100590165 (SOS1)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF Histone PH PH_19 PH_10 IQ_SEC7_PH PH_13
Other DBs
NCBI-GeneID: 100590165
NCBI-ProteinID: XP_003262811
Ensembl: ENSNLEG00000016450
UniProt: G1S388
LinkDB
Position
19
AA seq 1332 aa
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCADKVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGMEKICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQYRSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYLLQRMEEFIGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RRKVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
QTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMHR
DGPPLLENAHSS
NT seq 3999 nt   +upstreamnt  +downstreamnt
atgcaggcgcagcagctgccctacgagtttttcagcgaagagaacgcgcccaagtggcgg
ggattgctggtgcctgcgctgaaaaaggtccaggggcaagttcatcctactctcgagtct
aacgatgatgctcttcagtatgttgaagaattaattttgcaattattaaatatgctatgc
caagctcagccccgaagtgcttcagatgtagaggaacgtgttcaaaaaagtttccctcat
cctattgataagtgggcaatagctgatgcccaatcagctattgaaaagaggaagcgaaga
aaccctttatctctcccagtagaaaaaattcatcctttgttaaaggaggtcctaggttat
aaaattgaccaccaggtttctgtttacatagtagcagtcttagaatacatttctgcagac
attttaaagctggttgggaattatgtaagaaatatacggcattatgaaattacaaaacaa
gatattaaagtggcaatgtgtgctgacaaggtattgatggatatgtttcatcaagatgta
gaagatattaatatattatctttaactgatgaagagccttccacctcaggagaacaaact
tactatgatttggtaaaagcatttatggcagaaattcgacaatatataagggaactaaat
ctaattataaaagtttttagagagccctttgtctccaattcaaaactgttttcagctaat
gatgtagaaaatatatttagtcgcatagtagatatacatgaacttagcgtaaagttactg
ggccatatagaagatacagtagaaatgacagatgaaggcagtccccatcctctagtagga
agctgctttgaagacttagcagaggaactggcatttgatccatatgaatcgtatgctcga
gatattttgcgacctggttttcatgatcgtttccttagtcagttatcaaagcctggggca
gcactttatttgcagtcaataggcgaaggtttcaaagaagctgttcaatatgttttaccc
aggctacttctggcccctgtttaccactgtctccattactttgaacttttgaagcagtta
gaagaaaaaagtgaagatcaagaagacaaggaatgtttaaaacaagcaataacagctttg
cttaatgttcagagtggtatggaaaaaatatgttctaaaagtcttgcaaaacgaagactg
agtgaatccgcatgtcggttttatagtcagcaaatgaaggggaaacaactagcaatcaag
aaaatgaacgagattcagaagaatattgatggttgggagggaaaagacattggacagtgt
tgcaatgaatttataatggaaggaactcttacacgtgtaggagccaaacatgagagacac
atatttctctttgatggcttaatgatttgctgtaaatcaaatcatgggcagccaagactt
cctggtgctagcaatgcagaatatcgtcttaaagaaaagttttttatgcgaaaggtacaa
attaatgataaagatgacaccaatgaatacaagcatgcttttgaaataattttaaaagat
gaaaatagtgttatattttctgccaagtcagctgaagagaaaaacaattggatggcagca
ttgatatctttacagtaccggagtacactggaaaggatgcttgatgtaacaatgctacag
gaagagaaagaggagcagatgaggctgcctagtgctgatgtttatagatttgcagagcct
gactctgaagagaatattatatttgaagagaacatgcagcccaaggctggaattccaatt
atcaaagcaggaactgttattaaacttatagagaggcttacgtaccatatgtacgcagat
cccaattttgttcggacatttcttacaacatacagatccttttgcaaacctcaagaacta
ctgagtcttataatagaaaggtttgaaattccagagcctgagccaacagaagctgatcgc
atagctatagagaatggagatcaacccttgagtgcagaactaaaaagatttagaaaagaa
tatatacagcctgtgcaactgcgagtattaaatgtatgtcggcactgggtagagcaccac
ttctatgattttgaaagagatgcatatcttttgcaacgaatggaagaatttattggaaca
gtaagaggtaaagcaatgaaaaaatgggttgaatccatcactaaaataatccaaaggaaa
aaaattgcaagagacaatggaccaggtcataatatcacatttcagagttcacctcccaca
gttgagtggcatataagcagacctgggcacatagagacttttgacctgctcaccttacac
ccaatagaaattgctcgacaactcactttacttgaatcagatctataccgagctgtacag
ccatcagaattagttggaagtgtgtggacaaaagaagacaaagaaattaactctcctaat
cttctgaaaatgattcgacataccaccaacctcactctgtggtttgagaaatgtattgta
gaaactgaaaatttagaagaaagggtagctgtggtgagtcgaataattgagattctacaa
gtctttcaagagttgaacaactttaatggtgtccttgaggttgtcagtgctatgaattca
tcacctgtttacagactagaccacacatttgagcaaataccaagtcgccagaagaaaatt
ttagaagaagctcatgaattgagtgaagatcactataagaaatatttggcaaaactcagg
tctattaatccaccatgtgtgcctttctttggaatttatctcactaatatcttgaaaaca
gaagaaggcaaccctgaggtcctaaaaagacatggaaaagagcttataaactttagcaaa
aggaggaaagtagcagaaataacaggagagatccagcagtaccaaaatcagccttactgt
ttacgagtagaatcagatatcaaaaggttctttgaaaacttgaatccgatgggaaatagc
atggaaaaagaatttacagattatcttttcaacaaatccctagaaatagaaccacgaaac
cctaagcctctcccaagatttccaaaaaaatatagctatcccctaaaatctcctggtgtt
cgtccatcaaacccaagaccaggtaccatgaggcatcccacacctctgcagcaggagcca
aggaaaattagttatagtaggatccctgaaagtgaaacagaaagtacagcatctgcacca
aattctccaagaacaccgttaacacctccgcctgcttctggtgcttccagtaccacagat
gtttgcagtgtatttgattccgatcattcgagcccttttcactcaagcaatgataccgtc
tttatccaagttacactgccccatggcccaagatctgcttctgtatcatctataagttta
accaaaggcactgatgaagtgcctgtccctcctcctgttcctccacgaagacgaccagaa
tctgccccagcagaatcttcaccatctaagattatgtctaagcatttggacagcccccca
gccattcctcctaggcaacccacatcaaaagcctattcaccacgatattcaatatcagac
cggacctctatctcagaccctcctgaaagccctcccttattaccaccacgagaacctgtg
aggacacctgatgttttctcaagctcaccactacatctccaacctccccctttgggtaaa
aaaagtgatcatggcaatgccttcttcccaaacagcccttccccctttacaccacctcct
caaacaccttctcctcacggcacaagaaggcatctgccatcaccaccattgacacaagaa
gtggaccttcattccattgctgggccgcctgttcctccacgacaaagcacttctcaacat
atccctaaactccctccaaaaacttacaaaagggagcacacacacccatccatgcacaga
gatggaccaccactgttggagaatgcccattcttcctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600495
Entry
100600495         CDS       T03265                                 

Gene name
SOS2
Definition
(RefSeq) LOW QUALITY PROTEIN: son of sevenless homolog 2
  KO
K03099  son of sevenless
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04072  Phospholipase D signaling pathway
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04722  Neurotrophin signaling pathway
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04917  Prolactin signaling pathway
nle04926  Relaxin signaling pathway
nle04935  Growth hormone synthesis, secretion and action
nle05034  Alcoholism
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100600495 (SOS2)
   04012 ErbB signaling pathway
    100600495 (SOS2)
   04014 Ras signaling pathway
    100600495 (SOS2)
   04630 JAK-STAT signaling pathway
    100600495 (SOS2)
   04068 FoxO signaling pathway
    100600495 (SOS2)
   04072 Phospholipase D signaling pathway
    100600495 (SOS2)
   04151 PI3K-Akt signaling pathway
    100600495 (SOS2)
   04150 mTOR signaling pathway
    100600495 (SOS2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100600495 (SOS2)
   04540 Gap junction
    100600495 (SOS2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100600495 (SOS2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100600495 (SOS2)
   04660 T cell receptor signaling pathway
    100600495 (SOS2)
   04662 B cell receptor signaling pathway
    100600495 (SOS2)
   04664 Fc epsilon RI signaling pathway
    100600495 (SOS2)
   04062 Chemokine signaling pathway
    100600495 (SOS2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100600495 (SOS2)
   04912 GnRH signaling pathway
    100600495 (SOS2)
   04915 Estrogen signaling pathway
    100600495 (SOS2)
   04917 Prolactin signaling pathway
    100600495 (SOS2)
   04926 Relaxin signaling pathway
    100600495 (SOS2)
   04935 Growth hormone synthesis, secretion and action
    100600495 (SOS2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100600495 (SOS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100600495 (SOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100600495 (SOS2)
   05206 MicroRNAs in cancer
    100600495 (SOS2)
   05205 Proteoglycans in cancer
    100600495 (SOS2)
   05231 Choline metabolism in cancer
    100600495 (SOS2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100600495 (SOS2)
   05225 Hepatocellular carcinoma
    100600495 (SOS2)
   05226 Gastric cancer
    100600495 (SOS2)
   05214 Glioma
    100600495 (SOS2)
   05221 Acute myeloid leukemia
    100600495 (SOS2)
   05220 Chronic myeloid leukemia
    100600495 (SOS2)
   05211 Renal cell carcinoma
    100600495 (SOS2)
   05215 Prostate cancer
    100600495 (SOS2)
   05213 Endometrial cancer
    100600495 (SOS2)
   05224 Breast cancer
    100600495 (SOS2)
   05223 Non-small cell lung cancer
    100600495 (SOS2)
  09165 Substance dependence
   05034 Alcoholism
    100600495 (SOS2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100600495 (SOS2)
   05160 Hepatitis C
    100600495 (SOS2)
   05163 Human cytomegalovirus infection
    100600495 (SOS2)
   05165 Human papillomavirus infection
    100600495 (SOS2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100600495 (SOS2)
   01522 Endocrine resistance
    100600495 (SOS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:nle04990]
    100600495 (SOS2)
Domain-containing proteins not elsewhere classified [BR:nle04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   100600495 (SOS2)
SSDB
Motif
Pfam: RasGEF RasGEF_N RhoGEF PH Histone IQ_SEC7_PH PH_19 PH_13
Other DBs
NCBI-GeneID: 100600495
NCBI-ProteinID: XP_030666041
Ensembl: ENSNLEG00000012114
LinkDB
Position
1a
AA seq 1227 aa
MQPAPQPYEFFSEENSPKWRGLLVSALRKVQEQVHPTLSANEESLYYIEELIFQLLNKLC
MAQPRTVQDVEERVQKTFPHPIDKWAIADAQSAIEKRKRRNPLLLPVDKIHPSLKEVLGY
KVDYHVSLYIVAVLEYISADILKLAGNYVFNIRHYEISQQDIKVSMCADKVLMDMFDQDD
IGLVSLCEDEPSSSGELNYYDLVRTEITEERQYLRELNMIIKVFREAFLSDRKLFKPSDI
EKIFSNISDIHELTVKLLGLIEDTVEMTDESSPHPLAGSCFEDLAEEQAFDPYETLSQDI
LSPEFNEHFNKLMARPAVALHFQSIADGFKEAVRYVLPRLMLVPVYHCWHYFELLKQLKA
CSEEQEDRECLNQAITALLNLQGSLDRIYKQYSPRRRPGDPVCPFYGHQLRSKHLAIKKM
NEIQKNIDGWEGKDIGQCCNEFIMEGPLTRIGAKHERHIFLFDGLMISCKPNHGQTRLPG
YSSAEYRLKEKFVMRKIQICDKEDTCEYKHAFELVSKDENSIIFAAKSAEEKNNWMAALI
SLHYRSTLDRMLDSVLLKEENEQPLRLPSPEVYRFVVKDSEENIVFEDNLQSRSGIPIIK
GGTVVKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLLIERFEIPEPEPTDADKLA
IEKGEQPISADLKRFRKEYVQPVQLRILNVFRHWVEHHFYDFERDLELLERLESFISSVR
GKAMKKWVESIAKIIRRKKQAQANGISHNITFESPPPPIEWHISKPGQFETFDLMTLHPI
EIARQLTLLESDLYRKVQPSELVGSVWTKEDKEINSPNLLKIIRHTTNLTLWFEKCIVEA
ENFEERVAVLSRIIEILQVFQDLNNFNGVLEIVSAVNSVSVYRLDHTFEALQERKRKILD
EAVELSQDHFKKYLVKLKSINPPCVPFFGIYLTNILKTEEGNNDFLKKKGKDLINFSKRR
KVAEITGEIQQYQNQPYCLRIEPDMRRFFENLNPMGSASEKEFTDYLFNKSLEIEPRNCK
QPPRFPRKSTFSLKSPGIRPNTGRHGSTSGTLRGHPTPLEREPCKISFSRIAETELESTV
SAPTSPNTPSTPPVSASSDLSVFLDVDLNSSCGSNSIFAPVLLPHSKSFFSSCGSLHKLS
EEPLIPPPLPPRKKFDQDASNSKGNMKSDDDPPAIPPRQPPPPKVKPRVPVPTGAFMGLC
IVHLRHHQEILFLIPLHRFPFGLQNTL
NT seq 3684 nt   +upstreamnt  +downstreamnt
atgcagccggcgccgcagccttacgagttcttcagcgaggagaacagtccgaaatggcgg
ggactgttggtctcggccctgcggaaggttcaggaacaagtgcatcccactctctcagct
aatgaagagtctctctattatattgaagagctgatttttcagctgcttaataaattatgc
atggcccagccaaggactgttcaagatgtagaggagcgagttcagaagacctttcctcac
ccaattgataaatgggccattgctgatgcacaatctgctatagaaaaacgaaaacgaaga
aatcctcttttactgcctgtggacaaaatccatccttcgttgaaggaagtattagggtac
aaagtggactaccatgtgtccctatatattgtggctgtgctagagtatatctcagctgat
attttaaaattggctggtaattatgtttttaatatccggcattatgaaatatctcagcag
gacattaaagtgtcaatgtgtgcagataaggttttgatggacatgtttgatcaggatgac
ataggtttggtttctctctgtgaagatgaacctagttcttctggtgaattaaactactat
gatcttgtcagaactgaaatcacagaagaaagacagtatctacgggaattaaatatgatc
ataaaagtgtttcgagaagcctttctttctgatagaaagctgtttaaaccttctgatatc
gaaaagatttttagtaacatttcagatatacatgaattgactgtgaaacttttaggtttg
attgaagacacagttgaaatgactgatgaaagcagtcctcatcccttagctggcagctgt
tttgaagatttggcagaagagcaagcatttgatccttatgaaacattatcacaggacatt
ctttcaccagagtttaatgaacatttcaataaattgatggccagacctgcagttgctcta
cactttcagtccattgctgatggttttaaagaggcagttcgttatgtccttccacgtctt
atgctggtgccagtgtatcactgttggcactactttgagttactaaagcaattgaaagca
tgtagtgaagaacaagaagacagagaatgtttgaaccaagctattactgctctcctgaat
ctccaaggtagcttggaccgaatttacaagcagtattcacctagacgtcgacctggagat
cctgtttgccctttttatggtcaccaattaagaagcaaacacctggctatcaaaaaaatg
aatgaaattcagaaaaatattgatggatgggaaggcaaagatattggacagtgttgtaat
gaattcattatggagggaccattgacaagaatcggtgccaaacatgaacggcatattttt
ctgtttgatggcttaatgatcagttgtaaacctaatcatggccagactcggcttccaggt
tacagtagtgcagaatacaggttaaaagaaaaatttgtcatgaggaaaatacaaatttgt
gataaagaagatacttgtgagtacaagcatgcgtttgaattagtatccaaagatgagaac
agcataatatttgctgctaagtctgctgaagaaaaaaacaattggatggcagcccttatt
tctcttcattatcgtagtactctagatcgaatgttagattcagtattattgaaagaagaa
aatgagcaaccactgagattaccaagtcctgaagtatatcgttttgtagtaaaagactct
gaggaaaacattgtttttgaagacaacttgcaaagtagaagtggcatccccattattaaa
ggaggaactgtagtgaaattaattgaaaggttaacatatcatatgtatgcagatcccaat
tttgttcgtacttttcttaccacatatcgttcattttgtaaaccacaggaattgctgagc
ttactgattgaacggtttgaaattccagagccagaacctactgacgcagacaaattggca
atagagaaaggcgagcagccaatcagtgcagatcttaaaagatttcgcaaggaatacgtc
caaccagtacaacttaggatcttaaatgtatttcggcattgggttgaacatcatttttat
gactttgaaagagacttggaattgcttgaaagactagaatccttcatttcaagtgtaaga
gggaaagctatgaaaaaatgggtagagtcaatcgctaagatcatcaggaggaagaagcaa
gctcaggcaaatggaataagccataatattacctttgaaagtccacctccaccaattgaa
tggcatatcagcaaaccaggacagtttgaaacatttgatctcatgacacttcatccaata
gaaattgcacgtcagctgacacttttggagtctgatctctacaggaaagttcaaccatct
gaacttgtagggagtgtgtggaccaaagaagataaagaaataaattctccaaatttatta
aaaataattcgccataccacaaatctcaccctctggtttgaaaaatgcattgtggaagca
gaaaattttgaagaacgggtggcagtactaagtagaattatagaaattctgcaagttttt
caagatttgaataatttcaatggcgtattggagatagtcagtgcagtaaattcagtgtca
gtatacagactagaccatacctttgaggcattgcaggaaagaaaaaggaaaattttggat
gaagctgtggaattaagtcaagatcactttaaaaaatacctagtaaaacttaagtcaatc
aatccaccttgtgtgcctttttttggtatatatttaacaaatattctgaagaccgaagaa
gggaataatgattttttaaaaaagaaagggaaagatttaatcaatttcagtaagaggagg
aaagtagctgaaattactggagaaattcagcagtatcagaatcagccttactgtttacgg
atagaaccagatatgaggagattctttgaaaaccttaaccccatgggaagtgcatctgaa
aaagagttcacagattatttgttcaacaagtcactagaaattgaacctcgaaactgcaaa
cagccacctcgatttcctaggaaatcaactttctccttaaaatctcctggaataaggcct
aacacgggccgacatggctctacctcaggtactttacgaggtcacccaacaccgttagaa
agagaaccatgtaaaataagctttagtcggattgctgaaactgagctggaatcaacagtg
tcagcaccaacctctccaaatacaccatctactccaccagtatctgcttcttcagacctt
agtgtatttttagatgtggatctcaacagctcttgtggcagcaatagcatctttgctcca
gtgcttttgccacattcaaagtctttctttagttcatgtggtagtttacataaactaagt
gaagagcccctgattcctcctcctcttcctcctcgaaaaaagtttgatcaggatgcttca
aattccaagggaaatatgaaatctgatgatgatcctcctgctattccaccgagacagcct
cctcctccaaaggtaaaacccagagttcctgttcctactggtgcatttatgggcctctgc
atagtccacctccgccaccaccaagagatcctcttcctgatacccctccaccggttcccc
ttcggcctccagaacactttataa

DBGET integrated database retrieval system