KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100590186
Entry
100590186         CDS       T03265                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04371  Apelin signaling pathway
nle04912  GnRH signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle05020  Prion disease
nle05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100590186 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100590186 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    100590186 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    100590186 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100590186 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100590186 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100590186 (EGR1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100590186 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Cornifin Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 100590186
NCBI-ProteinID: XP_030684463
LinkDB
Position
2
AA seq 543 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SSSASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC
NT seq 1632 nt   +upstreamnt  +downstreamnt
atggccgcggccaaggccgagatgcagctgatgtccccgctgcagatctctgacccgttc
ggatcctttcctcactcgcccaccatggacaactaccctaagctggaggagatgatgctg
ctgagcaacggggctccccagttcctcggcgccgccggggccccagagggcagcggcagc
aacagcagcagcagcagcagcgggggtggtggaggcggcgggggcggcagcaacagcagc
agcagcagcagcaccttcaaccctcaggcggacacgggcgagcagccctacgagcacctg
accgcagagtcttttcctgacatctctctgaacaacgagaaggtgctggtggagacaagt
taccccagccaaaccactcgactgccccccatcacctatactggccgcttttccctggag
cctgcacccaacagtggtaacaccttgtggcccgagcccctcttcagcctggtcagtggc
ctcgtgagcatgaccaacccaccggcctcctcgtcctcagcaccatctccagcggcctcc
tcctcctccgcctcccagagcccacccctgagctgcgcagtgccatccaacgacagcagt
cccatttattcagcggcacccaccttccccacgccgaacactgacattttccctgagcca
caaagccaggccttcccgggctcggcagggacagcgctccagtacccgcctcctgcctac
cctgccgccaagggtggcttccaggttcccatgatccccgactacctgtttccacagcag
cagggggatctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgc
acccagcagccttcgctcacccccctgtctactatcaaggcctttgccactcagtcgggc
tcccaggacctgaaggccctcaataccagctaccagtcccagctcatcaaacccagccgc
atgcgcaagtaccccaaccggcccagcaagacgcccccccacgaacgcccttacgcttgc
ccagtggagtcctgtgatcgccgcttctcccgctccgacgagctcactcgccatatccgc
atccacacaggccagaagcccttccagtgccgcatctgcatgcgcaactttagccgcagc
gaccacctcaccacccacatccgcacccacacaggcgaaaagcccttcgcctgcgacatc
tgtgggagaaagtttgccaggagtgatgaacgcaagaggcataccaagatccacttgcgg
cagaaggacaagaaagcagacaaaagtgttgtggcctcttcagccacctcctctctctct
tcctacccatccccggttgctacctcttacccgtccccggttactacctcttatccatcc
ccagccaccacctcatacccatcccctgtgcccacctccttctcctctcccggctcctcg
acctacccatcccctgtgcacagtggcttcccctccccgtcggtggccaccacgtactcc
tccgttccccctgctttcccggcccaggtcagcagcttcccctcctcagctgtcaccaac
tccttcagcgcctccacagggctttcggacatgacagcaaccttttctcccaggacaatt
gaaatttgctaa

DBGET integrated database retrieval system