KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100591126
Entry
100591126         CDS       T03265                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04060  Cytokine-cytokine receptor interaction
nle04061  Viral protein interaction with cytokine and cytokine receptor
nle04151  PI3K-Akt signaling pathway
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04658  Th1 and Th2 cell differentiation
nle04659  Th17 cell differentiation
nle04660  T cell receptor signaling pathway
nle04672  Intestinal immune network for IgA production
nle04940  Type I diabetes mellitus
nle05135  Yersinia infection
nle05142  Chagas disease
nle05162  Measles
nle05166  Human T-cell leukemia virus 1 infection
nle05200  Pathways in cancer
nle05320  Autoimmune thyroid disease
nle05321  Inflammatory bowel disease
nle05330  Allograft rejection
nle05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100591126 (IL2)
   04151 PI3K-Akt signaling pathway
    100591126 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100591126 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100591126 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100591126 (IL2)
   04660 T cell receptor signaling pathway
    100591126 (IL2)
   04658 Th1 and Th2 cell differentiation
    100591126 (IL2)
   04659 Th17 cell differentiation
    100591126 (IL2)
   04672 Intestinal immune network for IgA production
    100591126 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100591126 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100591126 (IL2)
   05321 Inflammatory bowel disease
    100591126 (IL2)
   05330 Allograft rejection
    100591126 (IL2)
   05332 Graft-versus-host disease
    100591126 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100591126 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100591126 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100591126 (IL2)
   05162 Measles
    100591126 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100591126 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:nle04052]
    100591126 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:nle00536]
    100591126 (IL2)
Cytokines and growth factors [BR:nle04052]
 Cytokines
  Interleukins
   100591126 (IL2)
Glycosaminoglycan binding proteins [BR:nle00536]
 Heparan sulfate / Haparin
  Cytokines
   100591126 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 100591126
NCBI-ProteinID: XP_003271397
Ensembl: ENSNLEG00000009439
UniProt: G1RE34
LinkDB
Position
7b
AA seq 153 aa
MYRMQLLSCIALSLALVTNGAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVQELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaatggt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaacgtaatagttcaggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system