KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100592103
Entry
100592103         CDS       T03265                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04137  Mitophagy - animal
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04540  Gap junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04625  C-type lectin receptor signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05034  Alcoholism
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05207  Chemical carcinogenesis - receptor activation
nle05208  Chemical carcinogenesis - reactive oxygen species
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100592103 (NRAS)
   04012 ErbB signaling pathway
    100592103 (NRAS)
   04014 Ras signaling pathway
    100592103 (NRAS)
   04015 Rap1 signaling pathway
    100592103 (NRAS)
   04370 VEGF signaling pathway
    100592103 (NRAS)
   04371 Apelin signaling pathway
    100592103 (NRAS)
   04068 FoxO signaling pathway
    100592103 (NRAS)
   04072 Phospholipase D signaling pathway
    100592103 (NRAS)
   04071 Sphingolipid signaling pathway
    100592103 (NRAS)
   04151 PI3K-Akt signaling pathway
    100592103 (NRAS)
   04150 mTOR signaling pathway
    100592103 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100592103 (NRAS)
   04137 Mitophagy - animal
    100592103 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100592103 (NRAS)
   04218 Cellular senescence
    100592103 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100592103 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100592103 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100592103 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100592103 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    100592103 (NRAS)
   04660 T cell receptor signaling pathway
    100592103 (NRAS)
   04662 B cell receptor signaling pathway
    100592103 (NRAS)
   04664 Fc epsilon RI signaling pathway
    100592103 (NRAS)
   04062 Chemokine signaling pathway
    100592103 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100592103 (NRAS)
   04929 GnRH secretion
    100592103 (NRAS)
   04912 GnRH signaling pathway
    100592103 (NRAS)
   04915 Estrogen signaling pathway
    100592103 (NRAS)
   04917 Prolactin signaling pathway
    100592103 (NRAS)
   04921 Oxytocin signaling pathway
    100592103 (NRAS)
   04926 Relaxin signaling pathway
    100592103 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    100592103 (NRAS)
   04919 Thyroid hormone signaling pathway
    100592103 (NRAS)
   04916 Melanogenesis
    100592103 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100592103 (NRAS)
   04726 Serotonergic synapse
    100592103 (NRAS)
   04720 Long-term potentiation
    100592103 (NRAS)
   04730 Long-term depression
    100592103 (NRAS)
   04722 Neurotrophin signaling pathway
    100592103 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100592103 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100592103 (NRAS)
   04213 Longevity regulating pathway - multiple species
    100592103 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100592103 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100592103 (NRAS)
   05206 MicroRNAs in cancer
    100592103 (NRAS)
   05205 Proteoglycans in cancer
    100592103 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    100592103 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100592103 (NRAS)
   05203 Viral carcinogenesis
    100592103 (NRAS)
   05230 Central carbon metabolism in cancer
    100592103 (NRAS)
   05231 Choline metabolism in cancer
    100592103 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100592103 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100592103 (NRAS)
   05225 Hepatocellular carcinoma
    100592103 (NRAS)
   05226 Gastric cancer
    100592103 (NRAS)
   05214 Glioma
    100592103 (NRAS)
   05216 Thyroid cancer
    100592103 (NRAS)
   05221 Acute myeloid leukemia
    100592103 (NRAS)
   05220 Chronic myeloid leukemia
    100592103 (NRAS)
   05218 Melanoma
    100592103 (NRAS)
   05211 Renal cell carcinoma
    100592103 (NRAS)
   05219 Bladder cancer
    100592103 (NRAS)
   05215 Prostate cancer
    100592103 (NRAS)
   05213 Endometrial cancer
    100592103 (NRAS)
   05224 Breast cancer
    100592103 (NRAS)
   05223 Non-small cell lung cancer
    100592103 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100592103 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    100592103 (NRAS)
   05161 Hepatitis B
    100592103 (NRAS)
   05160 Hepatitis C
    100592103 (NRAS)
   05163 Human cytomegalovirus infection
    100592103 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100592103 (NRAS)
   05165 Human papillomavirus infection
    100592103 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100592103 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100592103 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    100592103 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100592103 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100592103 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100592103 (NRAS)
   01522 Endocrine resistance
    100592103 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100592103 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100592103 (NRAS)
   04031 GTP-binding proteins [BR:nle04031]
    100592103 (NRAS)
Membrane trafficking [BR:nle04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100592103 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100592103 (NRAS)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100592103 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   100592103 (NRAS)
  Exosomal proteins of breast cancer cells
   100592103 (NRAS)
  Exosomal proteins of colorectal cancer cells
   100592103 (NRAS)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100592103 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100592103
NCBI-ProteinID: XP_030680653
Ensembl: ENSNLEG00000034325
UniProt: A0A2I3HAD5
LinkDB
Position
12:61260733..61273042
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCVVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagcgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatcccaccatagaggattcttac
agaaaacaggtggttatagatggtgaaacctgtttgttggacatactggatacagctgga
caagaagagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaagtcatttgcggatattaacctctacagggagcagatt
aagcgagtaaaagactcggatgatgtacctatggtgctagtgggaaacaagtgtgatttg
ccaacaaggacagttgatacaaaacaagcccacgaactggccaagagttacgggattcca
ttcattgaaacctcagccaagaccagacagggtgttgaagatgctttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcagggt
tgtatgggattgccatgtgtggtgatgtaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593773
Entry
100593773         CDS       T03265                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04137  Mitophagy - animal
nle04140  Autophagy - animal
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04540  Gap junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04625  C-type lectin receptor signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04914  Progesterone-mediated oocyte maturation
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle04960  Aldosterone-regulated sodium reabsorption
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05034  Alcoholism
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05207  Chemical carcinogenesis - receptor activation
nle05208  Chemical carcinogenesis - reactive oxygen species
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100593773 (KRAS)
   04012 ErbB signaling pathway
    100593773 (KRAS)
   04014 Ras signaling pathway
    100593773 (KRAS)
   04015 Rap1 signaling pathway
    100593773 (KRAS)
   04370 VEGF signaling pathway
    100593773 (KRAS)
   04371 Apelin signaling pathway
    100593773 (KRAS)
   04068 FoxO signaling pathway
    100593773 (KRAS)
   04072 Phospholipase D signaling pathway
    100593773 (KRAS)
   04071 Sphingolipid signaling pathway
    100593773 (KRAS)
   04151 PI3K-Akt signaling pathway
    100593773 (KRAS)
   04150 mTOR signaling pathway
    100593773 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100593773 (KRAS)
   04137 Mitophagy - animal
    100593773 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100593773 (KRAS)
   04218 Cellular senescence
    100593773 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100593773 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100593773 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100593773 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100593773 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    100593773 (KRAS)
   04660 T cell receptor signaling pathway
    100593773 (KRAS)
   04662 B cell receptor signaling pathway
    100593773 (KRAS)
   04664 Fc epsilon RI signaling pathway
    100593773 (KRAS)
   04062 Chemokine signaling pathway
    100593773 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100593773 (KRAS)
   04929 GnRH secretion
    100593773 (KRAS)
   04912 GnRH signaling pathway
    100593773 (KRAS)
   04915 Estrogen signaling pathway
    100593773 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    100593773 (KRAS)
   04917 Prolactin signaling pathway
    100593773 (KRAS)
   04921 Oxytocin signaling pathway
    100593773 (KRAS)
   04926 Relaxin signaling pathway
    100593773 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    100593773 (KRAS)
   04919 Thyroid hormone signaling pathway
    100593773 (KRAS)
   04916 Melanogenesis
    100593773 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100593773 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100593773 (KRAS)
   04726 Serotonergic synapse
    100593773 (KRAS)
   04720 Long-term potentiation
    100593773 (KRAS)
   04730 Long-term depression
    100593773 (KRAS)
   04722 Neurotrophin signaling pathway
    100593773 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100593773 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100593773 (KRAS)
   04213 Longevity regulating pathway - multiple species
    100593773 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100593773 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593773 (KRAS)
   05206 MicroRNAs in cancer
    100593773 (KRAS)
   05205 Proteoglycans in cancer
    100593773 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    100593773 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100593773 (KRAS)
   05203 Viral carcinogenesis
    100593773 (KRAS)
   05230 Central carbon metabolism in cancer
    100593773 (KRAS)
   05231 Choline metabolism in cancer
    100593773 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100593773 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593773 (KRAS)
   05212 Pancreatic cancer
    100593773 (KRAS)
   05225 Hepatocellular carcinoma
    100593773 (KRAS)
   05226 Gastric cancer
    100593773 (KRAS)
   05214 Glioma
    100593773 (KRAS)
   05216 Thyroid cancer
    100593773 (KRAS)
   05221 Acute myeloid leukemia
    100593773 (KRAS)
   05220 Chronic myeloid leukemia
    100593773 (KRAS)
   05218 Melanoma
    100593773 (KRAS)
   05211 Renal cell carcinoma
    100593773 (KRAS)
   05219 Bladder cancer
    100593773 (KRAS)
   05215 Prostate cancer
    100593773 (KRAS)
   05213 Endometrial cancer
    100593773 (KRAS)
   05224 Breast cancer
    100593773 (KRAS)
   05223 Non-small cell lung cancer
    100593773 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100593773 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    100593773 (KRAS)
   05161 Hepatitis B
    100593773 (KRAS)
   05160 Hepatitis C
    100593773 (KRAS)
   05163 Human cytomegalovirus infection
    100593773 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100593773 (KRAS)
   05165 Human papillomavirus infection
    100593773 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100593773 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100593773 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    100593773 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100593773 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100593773 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100593773 (KRAS)
   01522 Endocrine resistance
    100593773 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100593773 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:nle04031]
    100593773 (KRAS)
Membrane trafficking [BR:nle04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100593773 (KRAS)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100593773 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 100593773
NCBI-ProteinID: XP_030660363
Ensembl: ENSNLEG00000027684
UniProt: G1QZK0
LinkDB
Position
23:8860309..8905951
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIIM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcattttgtggacgaatatgatccaacaatagaggattcctac
aggaagcaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggagtacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaatt
aaaagagttaaggactctgaagatgtacctatggtcctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattataatgtaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595274
Entry
100595274         CDS       T03265                                 
Symbol
HRAS
Name
(RefSeq) GTPase HRas isoform X1
  KO
K02833  GTPase HRas
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04071  Sphingolipid signaling pathway
nle04072  Phospholipase D signaling pathway
nle04137  Mitophagy - animal
nle04140  Autophagy - animal
nle04144  Endocytosis
nle04150  mTOR signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04210  Apoptosis
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04360  Axon guidance
nle04370  VEGF signaling pathway
nle04371  Apelin signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04625  C-type lectin receptor signaling pathway
nle04630  JAK-STAT signaling pathway
nle04650  Natural killer cell mediated cytotoxicity
nle04660  T cell receptor signaling pathway
nle04662  B cell receptor signaling pathway
nle04664  Fc epsilon RI signaling pathway
nle04714  Thermogenesis
nle04720  Long-term potentiation
nle04722  Neurotrophin signaling pathway
nle04725  Cholinergic synapse
nle04726  Serotonergic synapse
nle04730  Long-term depression
nle04810  Regulation of actin cytoskeleton
nle04910  Insulin signaling pathway
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04916  Melanogenesis
nle04917  Prolactin signaling pathway
nle04919  Thyroid hormone signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04929  GnRH secretion
nle04933  AGE-RAGE signaling pathway in diabetic complications
nle04935  Growth hormone synthesis, secretion and action
nle05010  Alzheimer disease
nle05022  Pathways of neurodegeneration - multiple diseases
nle05034  Alcoholism
nle05132  Salmonella infection
nle05160  Hepatitis C
nle05161  Hepatitis B
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05166  Human T-cell leukemia virus 1 infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05170  Human immunodeficiency virus 1 infection
nle05200  Pathways in cancer
nle05203  Viral carcinogenesis
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05207  Chemical carcinogenesis - receptor activation
nle05208  Chemical carcinogenesis - reactive oxygen species
nle05210  Colorectal cancer
nle05211  Renal cell carcinoma
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05220  Chronic myeloid leukemia
nle05221  Acute myeloid leukemia
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
nle05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100595274 (HRAS)
   04012 ErbB signaling pathway
    100595274 (HRAS)
   04014 Ras signaling pathway
    100595274 (HRAS)
   04015 Rap1 signaling pathway
    100595274 (HRAS)
   04370 VEGF signaling pathway
    100595274 (HRAS)
   04371 Apelin signaling pathway
    100595274 (HRAS)
   04630 JAK-STAT signaling pathway
    100595274 (HRAS)
   04068 FoxO signaling pathway
    100595274 (HRAS)
   04072 Phospholipase D signaling pathway
    100595274 (HRAS)
   04071 Sphingolipid signaling pathway
    100595274 (HRAS)
   04151 PI3K-Akt signaling pathway
    100595274 (HRAS)
   04150 mTOR signaling pathway
    100595274 (HRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100595274 (HRAS)
   04140 Autophagy - animal
    100595274 (HRAS)
   04137 Mitophagy - animal
    100595274 (HRAS)
  09143 Cell growth and death
   04210 Apoptosis
    100595274 (HRAS)
   04218 Cellular senescence
    100595274 (HRAS)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100595274 (HRAS)
   04540 Gap junction
    100595274 (HRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    100595274 (HRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100595274 (HRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100595274 (HRAS)
   04650 Natural killer cell mediated cytotoxicity
    100595274 (HRAS)
   04660 T cell receptor signaling pathway
    100595274 (HRAS)
   04662 B cell receptor signaling pathway
    100595274 (HRAS)
   04664 Fc epsilon RI signaling pathway
    100595274 (HRAS)
   04062 Chemokine signaling pathway
    100595274 (HRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100595274 (HRAS)
   04929 GnRH secretion
    100595274 (HRAS)
   04912 GnRH signaling pathway
    100595274 (HRAS)
   04915 Estrogen signaling pathway
    100595274 (HRAS)
   04917 Prolactin signaling pathway
    100595274 (HRAS)
   04921 Oxytocin signaling pathway
    100595274 (HRAS)
   04926 Relaxin signaling pathway
    100595274 (HRAS)
   04935 Growth hormone synthesis, secretion and action
    100595274 (HRAS)
   04919 Thyroid hormone signaling pathway
    100595274 (HRAS)
   04916 Melanogenesis
    100595274 (HRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    100595274 (HRAS)
   04726 Serotonergic synapse
    100595274 (HRAS)
   04720 Long-term potentiation
    100595274 (HRAS)
   04730 Long-term depression
    100595274 (HRAS)
   04722 Neurotrophin signaling pathway
    100595274 (HRAS)
  09158 Development and regeneration
   04360 Axon guidance
    100595274 (HRAS)
  09149 Aging
   04211 Longevity regulating pathway
    100595274 (HRAS)
   04213 Longevity regulating pathway - multiple species
    100595274 (HRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    100595274 (HRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100595274 (HRAS)
   05206 MicroRNAs in cancer
    100595274 (HRAS)
   05205 Proteoglycans in cancer
    100595274 (HRAS)
   05207 Chemical carcinogenesis - receptor activation
    100595274 (HRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    100595274 (HRAS)
   05203 Viral carcinogenesis
    100595274 (HRAS)
   05230 Central carbon metabolism in cancer
    100595274 (HRAS)
   05231 Choline metabolism in cancer
    100595274 (HRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100595274 (HRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100595274 (HRAS)
   05225 Hepatocellular carcinoma
    100595274 (HRAS)
   05226 Gastric cancer
    100595274 (HRAS)
   05214 Glioma
    100595274 (HRAS)
   05216 Thyroid cancer
    100595274 (HRAS)
   05221 Acute myeloid leukemia
    100595274 (HRAS)
   05220 Chronic myeloid leukemia
    100595274 (HRAS)
   05218 Melanoma
    100595274 (HRAS)
   05211 Renal cell carcinoma
    100595274 (HRAS)
   05219 Bladder cancer
    100595274 (HRAS)
   05215 Prostate cancer
    100595274 (HRAS)
   05213 Endometrial cancer
    100595274 (HRAS)
   05224 Breast cancer
    100595274 (HRAS)
   05223 Non-small cell lung cancer
    100595274 (HRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100595274 (HRAS)
   05170 Human immunodeficiency virus 1 infection
    100595274 (HRAS)
   05161 Hepatitis B
    100595274 (HRAS)
   05160 Hepatitis C
    100595274 (HRAS)
   05163 Human cytomegalovirus infection
    100595274 (HRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100595274 (HRAS)
   05165 Human papillomavirus infection
    100595274 (HRAS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100595274 (HRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100595274 (HRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    100595274 (HRAS)
  09165 Substance dependence
   05034 Alcoholism
    100595274 (HRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100595274 (HRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100595274 (HRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100595274 (HRAS)
   01522 Endocrine resistance
    100595274 (HRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    100595274 (HRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100595274 (HRAS)
   04031 GTP-binding proteins [BR:nle04031]
    100595274 (HRAS)
Membrane trafficking [BR:nle04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    100595274 (HRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    100595274 (HRAS)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100595274 (HRAS)
  Exosomal proteins of colorectal cancer cells
   100595274 (HRAS)
GTP-binding proteins [BR:nle04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    100595274 (HRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N
Other DBs
NCBI-GeneID: 100595274
NCBI-ProteinID: XP_030657983
LinkDB
Position
21:82526141..82529470
AA seq 198 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL
AARTVESRQAQDLARSYGIPYIETSAKTRQGSRSGSGSSSGTLWDPPGTHVTQRPLALEW
RMPSTRWCVRSGSTSCGS
NT seq 597 nt   +upstreamnt  +downstreamnt
atgacggaatataagctcgtggtggtgggcgccggcggtgtgggcaagagtgcgctgacc
atccagctaatccagaaccactttgtggacgaatatgaccccactatagaggactcctac
cggaagcaggtggtcattgatggggagacatgcctgttggacatcctggacacggccggc
caggaggagtacagcgccatgcgggaccagtacatgcgtaccggggagggcttcctgtgt
gtgtttgccatcaacaacaccaagtctttcgaggacatccaccagtacagggagcagatc
aaacgggtgaaggactcggacgacgtgcccatggtgctggtgggaaacaagtgtgatctg
gctgcacgcaccgtggagtctcggcaggctcaggacctcgcccgaagctacggcatcccc
tacatcgagacctcggccaagacccggcagggcagccgctctggctctggctccagctcc
gggaccctctgggacccccccgggacccatgtgacccagcggcccctcgcgctggagtgg
aggatgccttctacacgttggtgcgtgagatccggcagcacaagctgcggaagctga

DBGET integrated database retrieval system