KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593051
Entry
100593051         CDS       T03265                                 

Gene name
LEF1
Definition
(RefSeq) lymphoid enhancer-binding factor 1 isoform X3
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05132  Salmonella infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05221  Acute myeloid leukemia
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100593051 (LEF1)
   04390 Hippo signaling pathway
    100593051 (LEF1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100593051 (LEF1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100593051 (LEF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593051 (LEF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100593051 (LEF1)
   05225 Hepatocellular carcinoma
    100593051 (LEF1)
   05226 Gastric cancer
    100593051 (LEF1)
   05216 Thyroid cancer
    100593051 (LEF1)
   05221 Acute myeloid leukemia
    100593051 (LEF1)
   05217 Basal cell carcinoma
    100593051 (LEF1)
   05215 Prostate cancer
    100593051 (LEF1)
   05213 Endometrial cancer
    100593051 (LEF1)
   05224 Breast cancer
    100593051 (LEF1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100593051 (LEF1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100593051 (LEF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100593051 (LEF1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100593051 (LEF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100593051 (LEF1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100593051 (LEF1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100593051
NCBI-ProteinID: XP_003257780
Ensembl: ENSNLEG00000012942
UniProt: A0A2I3HVW3
LinkDB
Position
9
AA seq 371 aa
MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNE
SEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPDGGLYNKGPSYSSYSGYIMMPNM
NNDPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNS
KQGMSRHPPAPDIPTFYPLSPGGVGQITPPLGWFSHHMIPGPPGPHTTGIPHPAIVTPQV
KQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAA
INQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKREKLQESTS
GTGPRMTAAYI
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgccccaactctccggaggaggtggaggcggcgggggggacccggaactctgcgccacg
gacgagatgatccccttcaaggacgagggcgatcctcagaaggaaaagatcttcgccgag
atcagtcaccccgaagaggaaggcgatttagctgacatcaagtcttccttggtgaacgag
tctgaaatcatcccggccagcaacggacacgaggtggccagacaagcacaaacctctcag
gagccctaccatgacaaggccagagaacaccccgatgacggaaagcatccagatggaggc
ctctacaacaagggaccctcctactcgagttattccgggtacataatgatgccaaatatg
aataacgacccatacatgtcaaatggatctctttctccacccatcccgagaacatcaaat
aaagtgcccgtggtgcagccatcccatgcggtccatcctctcacccccctcatcacttac
agtgacgagcacttttctccaggatcacacccgtcacacatcccatcagatgtcaactcc
aaacaaggcatgtccagacatcctccagctcctgatatcccgactttttatcccttgtct
ccgggtggtgttggacagatcaccccacctcttggctggttttcccatcatatgattccc
ggtcctcctggtccccacacaactggcatccctcatccagctattgtaacacctcaggtc
aaacaggaacatccccacactgacagtgacctaatgcacgtgaagcctcagcatgaacag
agaaaggagcaggagccaaaaagacctcacattaagaagcctctgaatgcttttatgtta
tacatgaaagaaatgagagcgaatgtcgttgctgagtgtactctaaaagaaagtgcagct
atcaaccagattctcggcagaaggtggcatgccctctcccgtgaagagcaggctaaatat
tatgaattagcacggaaagaaagacagctacatatgcagctttatccaggctggtctgca
agagacaattatggtaagaaaaagaagaggaagagagagaaactacaggaatctacatca
ggtacaggtccaagaatgacagctgcctacatctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100595737
Entry
100595737         CDS       T03265                                 

Gene name
TCF7
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor 7
  KO
K02620  transcription factor 7
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04550  Signaling pathways regulating pluripotency of stem cells
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05132  Salmonella infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05221  Acute myeloid leukemia
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100595737 (TCF7)
   04390 Hippo signaling pathway
    100595737 (TCF7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100595737 (TCF7)
   04550 Signaling pathways regulating pluripotency of stem cells
    100595737 (TCF7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100595737 (TCF7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100595737 (TCF7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100595737 (TCF7)
   05225 Hepatocellular carcinoma
    100595737 (TCF7)
   05226 Gastric cancer
    100595737 (TCF7)
   05216 Thyroid cancer
    100595737 (TCF7)
   05221 Acute myeloid leukemia
    100595737 (TCF7)
   05217 Basal cell carcinoma
    100595737 (TCF7)
   05215 Prostate cancer
    100595737 (TCF7)
   05213 Endometrial cancer
    100595737 (TCF7)
   05224 Breast cancer
    100595737 (TCF7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100595737 (TCF7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100595737 (TCF7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100595737 (TCF7)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100595737 (TCF7)
   05165 Human papillomavirus infection
    100595737 (TCF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100595737 (TCF7)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100595737 (TCF7)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100595737
NCBI-ProteinID: XP_030684994
Ensembl: ENSNLEG00000008042
LinkDB
Position
2
AA seq 536 aa
MPQLDSGGGGAGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE
GAAGGAGIPGVPGAGAGARGEAEVGAEALGREHAAQRLFPDKLPEPLEDGLKAPECTSGM
YKETVYSAFNLLMHYPPASGAGQHPQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPA
DISQKQVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWFTHPSLMLGSGVPGHPAAIPHSAI
VPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFMLYMKEMRAKVIAECTLKES
AAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQES
TTDAAGSPKKCRARFGLNQQTDWCGPCRRKKKCIRYLPREGRCPSPVPSDDGALGCPESP
APQDSPSYRLLPRFPTELLTSPVEQHLHPQVSPLLSASQPQGPDRPPAAPCRAHKYSNRN
LRDRRPSRHRIPGRLQEPTPRENDKRPRSHGNRPGVLLTSSQGPDPEDFRGCRTSA
NT seq 1611 nt   +upstreamnt  +downstreamnt
atgccgcagctggactccggcgggggcggcgcgggcggcggcgacgacctcggcgcgccg
gacgagctgctggccttccaggatgagggcgaggagcaagacgacaagagccgcgacagc
gccgccggtcccgagcgcgacctggccgagctcaagtcgtcgctcgtgaacgagtccgag
ggcgcggccggcggcgcagggatcccgggggtcccgggagccggcgctggggcccgcggc
gaggctgaggtcggggccgaggctctcgggcgggaacacgctgcgcagagactcttcccg
gacaaacttccagagcccctggaggacggcctgaaggccccggagtgcaccagcggcatg
tacaaagagaccgtctactccgccttcaatctgctcatgcactacccacccgcctcggga
gcagggcagcacccccagccgcagcccccgctgcacaaggccaatcagcccccccacggt
gtcccccaactctctctctacgaacatttcaacagcccacatcccacccctgcacctgcg
gacatcagccagaagcaagttcacaggcctctgcagacccctgacctctctggcttctac
tccctgacctcaggcagcatggggcagctcccccacactgtgagctggttcacccaccca
tccttgatgctaggttctggtgtacctggtcacccagcagccatcccccactcggccatc
gtgcccccctcagggaagcaggagctgcagcccttcgaccgcaacctgaagacacaagca
gagtccaaggcagagaaggaggccaagaagccaaccatcaagaagcccctcaatgccttc
atgctgtacatgaaggagatgagagccaaggtcatcgcagagtgcacacttaaggagagc
gctgccatcaaccagatcctgggccgcaggtggcatgcgctgtcgcgagaagagcaggcc
aagtactatgagctggcccgcaaggagaggcagctgcacatgcagctatacccaggctgg
tcagcgcgggacaactacgggaagaagaagaggcggtcgagggaaaagcaccaagaatcc
accacagacgctgctggctcgcctaagaaatgccgtgctcgctttggcctcaaccagcag
acggattggtgtggtccgtgcaggaggaaaaagaaatgcattcggtacttacccagagaa
ggccgctgccccagccccgttccttccgatgacggtgctctaggctgccctgagtcccca
gctccccaggactcaccctcataccgtctgctgccccgcttccccacagaactgcttact
agccctgtggagcagcacctacatccccaggtgtctccactgctctcagcctcccagccc
cagggccccgacaggccccccgcagcaccctgcagagcacacaagtacagcaacaggaat
ctcagagacaggcggcctagcaggcacaggatacctggccgcctccaggagcctaccccg
agagaaaatgacaagagacccagatcgcatggaaaccggccaggggtcctgttaacgtca
tctcagggtccagaccctgaagatttcagaggctgcagaacttctgcctga

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601518
Entry
100601518         CDS       T03265                                 

Gene name
TCF7L1
Definition
(RefSeq) transcription factor 7-like 1
  KO
K04490  transcription factor 7-like 1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05132  Salmonella infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05221  Acute myeloid leukemia
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100601518 (TCF7L1)
   04390 Hippo signaling pathway
    100601518 (TCF7L1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100601518 (TCF7L1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100601518 (TCF7L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100601518 (TCF7L1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100601518 (TCF7L1)
   05225 Hepatocellular carcinoma
    100601518 (TCF7L1)
   05226 Gastric cancer
    100601518 (TCF7L1)
   05216 Thyroid cancer
    100601518 (TCF7L1)
   05221 Acute myeloid leukemia
    100601518 (TCF7L1)
   05217 Basal cell carcinoma
    100601518 (TCF7L1)
   05215 Prostate cancer
    100601518 (TCF7L1)
   05213 Endometrial cancer
    100601518 (TCF7L1)
   05224 Breast cancer
    100601518 (TCF7L1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100601518 (TCF7L1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100601518 (TCF7L1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100601518 (TCF7L1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100601518 (TCF7L1)
   05165 Human papillomavirus infection
    100601518 (TCF7L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100601518 (TCF7L1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100601518 (TCF7L1)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2 NINJA_B
Other DBs
NCBI-GeneID: 100601518
NCBI-ProteinID: XP_030683850
Ensembl: ENSNLEG00000001462
LinkDB
Position
14
AA seq 588 aa
MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPARDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPSSPPTHLSPEIDPKTGIPRTPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSAKSPVTVRKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPTTLHAHQALPVLQAQPLSLVTKSAH
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgccccagctcggcggcgggggcggcggcggcggcggcggcagcgggggaggcggcggc
tccagcgccggggcggccggcggaggggacgacctcggggcgaacgacgagctgatcccc
ttccaggacgagggaggcgaggagcaggagccgagcagcgacagcgcctcggcgcaacgg
gacctagacgaggtcaagtcgtccctggtcaacgagtcggagaaccagagcagcagctcg
gactcggaggcagagaggcgcccgcagcccgcccgggacactttccagaagccacgggac
tatttcgccgaagtgagaaggccccaggacagcgcgttctttaaaggacccccctaccct
gggtaccccttcctgatgatcccggacctgagcagcccgtacctctccaacggacccctg
tctcccggaggagcgcgcacctacctgcagatgaaatggcccctcctcgatgtcccctcc
agcgccacagtcaaggacacgaggtcaccatctccagcacacttgtctaataaagttcct
gtcgttcagcacccgcatcacatgcatccgctgactcccctcatcacctacagcaatgac
cacttctcccccagctcccctcccacccacctctccccagagatcgatccaaagacagga
atcccccggacccctcacccatccgagctgtcaccgtattacccactctctcccggagct
gtcggacaaatcccccaccccctcggctggctcgtcccacagcaaggccagcccatgtac
tcccttcctcctggtggcttccggcacccttaccctgcccttgccatgaacgcctcgatg
tccagcctggtctccagtcggttctctcctcacatggtggctcccgcccaccctggcctg
cccacctcagggatcccccaccctgccatcgtctcccccatcgtcaagcaggaaccggca
ccccccagcctgagccctgcagtgagcgcgaaatcaccagtcaccgtgagaaaggaggaa
gaaaagaagccccacgtgaagaagcctcttaatgccttcatgttgtatatgaaggagatg
agggccaaggtggtggctgagtgcaccctgaaggaaagtgcagccattaaccagatcctg
ggaagaaagtggcacaacctgtctcgagaagaacaggccaagtactacgagctggcccgg
aaggagcggcagcttcactcgcagctctacccgacctggtcagcccgggacaactatggt
aagaaaaagaagaggaagagagaaaagcagctctcccagacacagtcacagcagcaagtc
caggaggcagagggtgccctggcctccaagagcaagaagccatgtgttcagtacctgccc
cccgagaagccctgtgacagccctgcctcctctcacgggagcatgctggactccccggcc
accccctctgcagctttggcctcaccagctgcccctgctgccacccattcggagcaagcc
cagcccctctccctcaccaccaaaccagaaacccgggcccagctggctctccactctgct
gccttcctgtcagctaaggctgcagcctcctcctctgggcagatgggcagccagcctccc
ctcctgtcccggcccctcccccttgggtccatgcccacagctctgctggcctctcccccg
tccttccccaccacgctccatgcccaccaggccctcccggtgctacaggcccagcctctt
tccctggtcaccaagtctgcccactaa

KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605701
Entry
100605701         CDS       T03265                                 

Gene name
TCF7L2
Definition
(RefSeq) transcription factor 7-like 2 isoform X1
  KO
K04491  transcription factor 7-like 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04310  Wnt signaling pathway
nle04390  Hippo signaling pathway
nle04520  Adherens junction
nle04916  Melanogenesis
nle04934  Cushing syndrome
nle05132  Salmonella infection
nle05165  Human papillomavirus infection
nle05167  Kaposi sarcoma-associated herpesvirus infection
nle05200  Pathways in cancer
nle05210  Colorectal cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05221  Acute myeloid leukemia
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100605701 (TCF7L2)
   04390 Hippo signaling pathway
    100605701 (TCF7L2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100605701 (TCF7L2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100605701 (TCF7L2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605701 (TCF7L2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100605701 (TCF7L2)
   05225 Hepatocellular carcinoma
    100605701 (TCF7L2)
   05226 Gastric cancer
    100605701 (TCF7L2)
   05216 Thyroid cancer
    100605701 (TCF7L2)
   05221 Acute myeloid leukemia
    100605701 (TCF7L2)
   05217 Basal cell carcinoma
    100605701 (TCF7L2)
   05215 Prostate cancer
    100605701 (TCF7L2)
   05213 Endometrial cancer
    100605701 (TCF7L2)
   05224 Breast cancer
    100605701 (TCF7L2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100605701 (TCF7L2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100605701 (TCF7L2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100605701 (TCF7L2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100605701 (TCF7L2)
   05165 Human papillomavirus infection
    100605701 (TCF7L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100605701 (TCF7L2)
Transcription factors [BR:nle03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    100605701 (TCF7L2)
SSDB
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 100605701
NCBI-ProteinID: XP_030662750
Ensembl: ENSNLEG00000015863
LinkDB
Position
3
AA seq 672 aa
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVQSPFPCCTQGHDCQHFYPPSDFTVSTQVFRDMKRSHSLQKVGEPWCIESNKVPVVQ
HPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQ
IPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSSFLSSRFPPHMVPPHHTLHTT
GIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKK
KRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCRRKKKCV
RYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKPDPLAHLS
MMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSHSSLAGTQ
PQPLSLVTKSLE
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggggatgacctaggcgccaacgacgaactgatttcc
ttcaaagacgagggcgaacaggaggagaagagctccgaaaactcctcggcagagagggat
ttagctgatgtcaaatcgtctctagtcaatgaatcagaaacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagacaaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaaccctccattttcagtccggcagcacacattactctgcgtac
aaaacgattgaacaccagattgcagttcagtatctccagatgaaatggccactgcttgat
gtccaggcagggagcctccagagtagacaagccctcaaggatgcccggtccccatcgccg
gcacacattgtccagagccccttcccttgctgcactcagggacatgactgtcagcacttc
taccccccctcagacttcactgtcagcactcaagtcttcagggacatgaaaaggagccac
tccttacaaaaagttggggagccctggtgtattgagtcgaacaaagtgccagtggtgcag
caccctcaccatgtccaccccctcacgcctcttatcacgtacagcaatgaacacttcacg
ccgggaaacccacctccacacttaccagccgacgtagaccccaaaacaggaatcccacgg
cctccgcaccctccagatatatccccgtattacccactatcgcctggcaccgtaggacaa
atcccccatccgctaggatggttagtaccacagcaaggtcaaccagtgtacccaatcaca
acaggaggattcagacacccctaccccacagctctgaccgtcaatgcttccatgtccagc
tttctgtcttctaggttccctccccatatggtcccaccacatcatacgctacacacgacg
ggcattccgcatccggccatagtcacaccaacagtcaaacaggaatcgtcccagagtgac
gtcggctcactccatagctcaaagcatcaggactccaaaaaggaagaagaaaagaagaag
ccccacataaagaaacctcttaatgcattcatgttgtatatgaaggaaatgagagcaaag
gtcgtagctgagtgcacgttgaaagaaagcgcggccatcaaccagatccttgggcggagg
tggcatgcactgtccagagaagagcaagcaaaatactacgagctggcccggaaggagcga
cagcttcatatgcaactgtaccccggctggtccgcgcgggataactatggaaagaagaag
aagaggaaaagggacaagcagccgggagagaccaatgaacacagcgaatgtttcctaaat
ccttgcctttcacttcctccgattacagacctgagcgctcctaagaaatgccgagcgcgc
tttggccttgatcaacagaataactggtgcggcccttgcaggagaaaaaaaaagtgcgtt
cgctacatacaaggtgaaggcagctgcctcagcccaccctcttcagatggaagcttacta
gattcgcctcccccctcccccaacctgctaggctcccctccccgagacgccaagtcacag
actgagcagacccagcctctgtcgctgtccctgaagcccgaccccctggcccacctgtcc
atgatgcctccgccgcccgccctcctgctcgccgaggccacccacaaggcctccgccctc
tgtcccaacggggccctggacctgcccccagccgctttgcagcctgccgccccctcctca
tcaattgcacagccgtcgacttcttccttacattcccacagctccctggccgggacccag
ccccagccgctgtcgctcgtcaccaagtctttagaatag

DBGET integrated database retrieval system