KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593147
Entry
100593147         CDS       T03265                                 

Gene name
SUFU
Definition
(RefSeq) suppressor of fused homolog isoform X2
  KO
K06229  suppressor of fused
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04340  Hedgehog signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100593147 (SUFU)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100593147 (SUFU)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100593147 (SUFU)
SSDB
Motif
Pfam: SUFU_C SUFU
Other DBs
NCBI-GeneID: 100593147
NCBI-ProteinID: XP_003255447
Ensembl: ENSNLEG00000015166
LinkDB
Position
3
AA seq 484 aa
MAELRPSGAPGPTAPPAPGPTAPPAFASLFPPGLHAIYGECRRLYPDQPNPLQVTAIVKY
WLGGPDPLDYVSMYRNVGSPSANIPEHWHYISFGLSDLYGDNRVHEFTGTDGPSGFGFEL
TFRLKRETGESAPPTWPAELMQGLARYVFQSENTFCSGDHVSWHSPLDNSESRIQHMLLT
EDPQMQPVQTPFGVVTFLQIVGVCTEELHSAQQWNGQGILELLRTVPVAGGPWLITDMRR
GETIFEIDPHLQERVDKGIETDGSNLSGVSAKCAWDDLSRPPEDDEDSRSICIGTQPRRL
SGKDTEQIRETLRRGLEINSKPVLPPINPQRQNGLAHDRVPSRKDSLESDSSTAIIPHEL
IRTRQLESVHLKFNQESGALIPLCLRGRLLHGRHFTYKSITGDMAITFVSTGVEGAFATE
EHPYAAHGPWLQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD
SPLH
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcggagctgcggcctagcggcgcccccggccccactgcgcccccggcccctggcccg
actgcccccccggccttcgcttcgctctttcccccgggactgcacgccatctacggagag
tgccgccgcctttaccctgaccagccgaacccgctccaggttactgctatcgtcaagtac
tggttgggtggcccagaccccttggactatgttagcatgtacaggaatgtggggagccct
tctgctaacatccccgagcactggcactacatcagcttcggcctgagtgatctctatggc
gacaacagagtccatgagtttacaggaacagatggacctagtggttttggctttgagttg
acctttcgtctgaagagagaaactggggagtctgccccaccaacatggcccgcagagtta
atgcagggcttggcacgatacgtgttccagtcagagaacaccttctgcagtggggaccat
gtgtcctggcacagccctttggataacagtgagtcaagaattcagcacatgctgctgaca
gaggacccacagatgcagcccgtgcagacaccctttggggtagttaccttcctccagatc
gttggtgtctgcactgaagagctacactcagcccagcagtggaatgggcagggcatcctg
gagctgctgcggacagtgcctgttgctggcggcccctggctgataactgacatgcggagg
ggagagaccatatttgagatcgatccacacctgcaagagagagttgataaaggcatcgag
acagatggctccaacctgagcggtgtcagtgccaagtgtgcctgggatgacctgagccgg
ccccccgaggatgacgaggacagccggagcatctgcatcggcacacagccccggcgactc
tctggcaaagacacagagcagatccgggagaccctgaggagaggactcgagatcaacagc
aaacctgtccttccgccaatcaaccctcagcggcagaatggcctcgcccacgaccgggtc
ccgagccgcaaagacagcctggaaagtgacagctccacggccatcattccccatgagctg
attcgcacgcggcagctcgagagcgtacatctgaaattcaaccaggagtccggagccctc
attcctctctgcctaaggggcaggctcctgcatggacggcactttacatataaaagtatc
acaggtgacatggccatcacgtttgtctccacgggagtggaaggcgcctttgccaccgag
gagcatccttacgcagctcatggaccctggttacaaattctgttgaccgaagagtttgta
gagaaaatgttggaggatttagaagatttgacttctccagaggaattcaaacttcccaaa
gagtacagctggcctgaaaagaagctgaaggtctccatcctgcctgacgtagtgttcgac
agtccgctacactag

DBGET integrated database retrieval system