KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100597255
Entry
100597255         CDS       T03265                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04068  FoxO signaling pathway
nle04072  Phospholipase D signaling pathway
nle04144  Endocytosis
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04520  Adherens junction
nle04540  Gap junction
nle04630  JAK-STAT signaling pathway
nle04810  Regulation of actin cytoskeleton
nle04912  GnRH signaling pathway
nle04915  Estrogen signaling pathway
nle04921  Oxytocin signaling pathway
nle04926  Relaxin signaling pathway
nle04928  Parathyroid hormone synthesis, secretion and action
nle04934  Cushing syndrome
nle05160  Hepatitis C
nle05163  Human cytomegalovirus infection
nle05165  Human papillomavirus infection
nle05171  Coronavirus disease - COVID-19
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05219  Bladder cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
nle05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100597255 (EGFR)
   04012 ErbB signaling pathway
    100597255 (EGFR)
   04014 Ras signaling pathway
    100597255 (EGFR)
   04015 Rap1 signaling pathway
    100597255 (EGFR)
   04630 JAK-STAT signaling pathway
    100597255 (EGFR)
   04066 HIF-1 signaling pathway
    100597255 (EGFR)
   04068 FoxO signaling pathway
    100597255 (EGFR)
   04020 Calcium signaling pathway
    100597255 (EGFR)
   04072 Phospholipase D signaling pathway
    100597255 (EGFR)
   04151 PI3K-Akt signaling pathway
    100597255 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100597255 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100597255 (EGFR)
   04520 Adherens junction
    100597255 (EGFR)
   04540 Gap junction
    100597255 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100597255 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100597255 (EGFR)
   04915 Estrogen signaling pathway
    100597255 (EGFR)
   04921 Oxytocin signaling pathway
    100597255 (EGFR)
   04926 Relaxin signaling pathway
    100597255 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100597255 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100597255 (EGFR)
   05206 MicroRNAs in cancer
    100597255 (EGFR)
   05205 Proteoglycans in cancer
    100597255 (EGFR)
   05230 Central carbon metabolism in cancer
    100597255 (EGFR)
   05231 Choline metabolism in cancer
    100597255 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100597255 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100597255 (EGFR)
   05212 Pancreatic cancer
    100597255 (EGFR)
   05225 Hepatocellular carcinoma
    100597255 (EGFR)
   05226 Gastric cancer
    100597255 (EGFR)
   05214 Glioma
    100597255 (EGFR)
   05218 Melanoma
    100597255 (EGFR)
   05219 Bladder cancer
    100597255 (EGFR)
   05215 Prostate cancer
    100597255 (EGFR)
   05213 Endometrial cancer
    100597255 (EGFR)
   05224 Breast cancer
    100597255 (EGFR)
   05223 Non-small cell lung cancer
    100597255 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100597255 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100597255 (EGFR)
   05171 Coronavirus disease - COVID-19
    100597255 (EGFR)
   05163 Human cytomegalovirus infection
    100597255 (EGFR)
   05165 Human papillomavirus infection
    100597255 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100597255 (EGFR)
   01522 Endocrine resistance
    100597255 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100597255 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100597255 (EGFR)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100597255 (EGFR)
Protein kinases [BR:nle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100597255 (EGFR)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100597255 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100597255 (EGFR)
  Exosomal proteins of bladder cancer cells
   100597255 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 100597255
NCBI-ProteinID: XP_030651630
Ensembl: ENSNLEG00000008441
LinkDB
Position
17
AA seq 1209 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQVMNITCTGQGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADASHVCHLCHPNCTYGCAGPGLEGCANGPKIPSIATGMVGALLLLLVVA
LGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSG
AFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGIC
LTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAAR
NVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYG
VTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKF
RELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQ
GFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDS
IDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPTPSRDPHYQDPHSTAVGNPEYLNT
VQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVA
PQSSEFIGA
NT seq 3630 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggacggccggggcagcgctcctggcgctgctggctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaataagctcacacag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtt
gtccttgggaatttggaaattacctacgtgcagaggaattacgatctttccttcttgaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgtactatgaaaattcctacgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagtgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgtggcaagtcccccagtgactgctgccataaccagtgtgccgcgggctgc
acgggcccccgagagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctttacaaccccaccacgtaccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgcggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacaaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccgcctctggacccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagtgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccctgagggctgctggggcccagagccc
agggactgcgtctcctgccggaatgtcagccgaggcagggaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggtcatgaacatcacctgcacgggacagggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtatgcagacgccagccacgtgtgccacctgtgc
catccaaactgcacctacggatgcgctgggccaggtcttgaaggctgtgcgaatgggcct
aagattccgtccattgccactgggatggtgggggccctcctcttgctgctggtggtggcc
ctggggatcggcctcttcatgcgaaggcgccacatcgttcggaagcgcacactgcggagg
ctgctgcaggagagggagcttgtggagcctcttacgcccagtggagaagctcccaaccaa
gctctcttgaggatcttgaaggaaactgaattcaaaaagatcaaagtgctgggctccggc
gcgttcggcactgtgtataagggactctggatcccagaaggtgagaaagttaaaattccc
gttgctatcaaggaattaagagaagcaacgtctccgaaagccaacaaggaaatcctcgat
gaagcctacgtgatggccagcgtggacaacccccacgtgtgccgccttctgggcatctgc
ctcacctccaccgtgcagctcatcacgcagctcatgcccttcggctgcctcctcgactat
gtccgggaacacaaagacaatatcggctcccagtacctgctcaactggtgtgtgcagatc
gcaaagggcatgaactacttagaggaccggcgcttggtgcaccgggacctggcagccagg
aacgtactggtgaaaacaccgcagcatgtcaagatcacagattttgggctggccaaactg
ctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtggatg
gcattggaatcaattttacaccgaatttatacccaccagagtgatgtctggagctatggg
gtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgccagc
gagatctcctccatcctggaaaaaggagaacgcctcccccagccacccatatgcaccatc
gatgtctacatgatcatggtcaagtgctggatgatagacgcagatagtcgcccaaagttc
cgtgagttgatcatcgaattctccaaaatggcccgagacccccagcgctaccttgtcatt
cagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgccctg
atggatgaagaagacatggacgatgtggtggatgccgacgagtacctcatcccacagcag
ggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgcaacc
agcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatcaag
gaagacagcttcttgcagcgatacagctcagaccccacaggtgccttgactgaggacagc
atagacgacaccttcctcccagtgcctgaatacataaaccagtcggttcccaaaaggccc
gctggctctgtgcagaatcctgtctatcataatcagcctctgaaccccacacccagcaga
gatccacactaccaggacccccacagcactgcagtgggcaaccccgagtatctcaacact
gtccagcctacctgtgtcaacagcacattcgacagccctgcccactgggcccagaaaggc
agccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaagcc
aagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtcgcg
ccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system