KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100598379
Entry
100598379         CDS       T03265                                 

Gene name
ILK
Definition
(RefSeq) integrin-linked protein kinase isoform X2
  KO
K06272  integrin-linked kinase [EC:2.7.11.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03320  PPAR signaling pathway
nle04360  Axon guidance
nle04510  Focal adhesion
nle05100  Bacterial invasion of epithelial cells
nle05213  Endometrial cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100598379 (ILK)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100598379 (ILK)
  09158 Development and regeneration
   04360 Axon guidance
    100598379 (ILK)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100598379 (ILK)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100598379 (ILK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100598379 (ILK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nle03036]
    100598379 (ILK)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100598379 (ILK)
Protein kinases [BR:nle01001]
 Serine/threonine kinases: TKL group
  MLK family
   100598379 (ILK)
Chromosome and associated proteins [BR:nle03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100598379 (ILK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ank_4 Ank_5 Pkinase Ank_2 Ank Ank_3
Other DBs
NCBI-GeneID: 100598379
NCBI-ProteinID: XP_003254909
Ensembl: ENSNLEG00000017450
UniProt: G1S6P2
LinkDB
Position
15
AA seq 452 aa
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcttgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgttgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaatgaacatggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccacccgcactcggccccgaaatgga
accctgaacaaacactctggcattgacttcaaacagcttaacttcctgacgaagctcaac
gagaatcactctggagagctatggaagggccgctggcagggcaatgacattgtcgtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaagagtgtccc
cggctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgccagtctcca
cctgctcctcatcctactcttatcacacactggatgccatatggatccctctacaatgta
ctacatgaaggcaccaatttcgtcgtggaccagagccaggctgtgaagtttgctttggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccgaattagcatggctgatgtc
aagttctctttccaatgtcctggtcgcatgtatgcacctgcctgggtggcccctgaagct
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagta
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaatatggagatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggtatttcccctcat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgcaaagcgacccaaatttgac
atgattgtgcctatcctggagaagatgcaggacaagtag

DBGET integrated database retrieval system