KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100599158
Entry
100599158         CDS       T03265                                 

Gene name
GLI1
Definition
(RefSeq) zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04024  cAMP signaling pathway
nle04340  Hedgehog signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100599158 (GLI1)
   04024 cAMP signaling pathway
    100599158 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100599158 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100599158 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100599158 (GLI1)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    100599158 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 100599158
NCBI-ProteinID: XP_030678220
Ensembl: ENSNLEG00000017337
LinkDB
Position
11
AA seq 1106 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGSARETN
SYTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPLPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSNEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTPVSRRAGPPVSLD
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASAGGGG
TPPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPARAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPADTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPSPKALGGTYSQCPRLEHYGQVQVKPEQACPVGSDSTGLAPCLSAHPSEG
PPHPQPLISHYPQPPPPQYLQSGPYPQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSPAKAPVTTYGPGFGPNLPNHK
SGSYLTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETQFLNSSA
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccagtcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcccgcccttc
tgccaccaagctaacctcatgtccggcccccacagttatgggtcagccagagagaccaac
agctacaccgagggcccactcttttcttctccccggagtgcagtcaagttgaccaagaag
cgggcactgtccatctcacctctgtcagatgccagcctggacctgcagacggttatccgc
acctcacccagctccctcgtagctttcatcaactcacgatgcacatctccaggaggctcc
tacggtcatctctccattggcaccatgagcccatctctgggattcccagcccagatgaat
caccaaaaagggccctcgccttccttcggggtccagccttgtggtccccatgactccgcc
cggggcgggatgatcccacatcctcagtcccggggacccctcccaacttgccagctgaag
tctgagctggacatgctggttggcaagtgccgggaggaacccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
cttgagagagaggagaagcgtgagcctgaatctgtgtatgaaactgactgccgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgagcac
atccacggggagcggaaagagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtatatgctggtggtgcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagacg
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcatgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccgtatgtgtgtaagctccctggctgcaccaaacgctatacagatcccagctcactgcga
aaacatgtcaagacagtgcatggtcctgacgcccatgtgaccaaacggcaccgaggggat
ggccccctgcctcgggcaccatccatttctacagtggagcccaagagggagcgggaagga
ggtcccatcagggaggagagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcaggcagtgcagccaat
acagacagcggtgtggaaatgactggcaatgcagggggcagcaatgaagacctctccagc
ttggacgagggaccttgcatcgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccagctgcatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacaccggtacccctgtgtcccgccgcgcgggccccccagtctctcttgac
cgccgcagcagcagctccagcagcatcagctctgcctatactgtcagccgccgctcctcc
ctggcctctcctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgctccgggcaagatatgcttcagccggagggggtggt
actccacccactgcagcatccagcctggatcggatagggggtcttcccatgcctccttgg
agaagccgagccgagtatccaggatacaaccccaatgcaggggtcacccggagggccagt
gacccagcccgggctgctgaccgtcctgctccagctagagtccagaggttcaagagcctg
ggctgtgtccataccccacccactgtggcagggggaggacagaactttgatccttacctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgctgccatggatgct
agagggctacaggaagagccagaagttgggacctctatggtgggcagtggtctgaacccc
tatatggacttcccacctgctgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctctctgccccttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaagccccaaggctctaggtggaacctac
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccggaacaggcgtgc
ccagtggggtctgactccacaggactggcaccctgcctcagtgcccaccccagtgagggg
cccccacatccacagcctctcatttcccattacccccagccccctcctccccagtatctc
cagtcaggcccctatccccagccaccccctgattatcttccttcagaacccagaccttgc
ctggactttgattcccccacccattccacagggcagctcaaggctcagcttgtgtgtaat
tatgttcaatctcaacaggagctgctgtgggagggtgggggcagggaagatgccccagcc
caggaaccttcctaccagagtcctaagtttctggggggttcccaggttagcccaagccct
gctaaagctccagtgaccacatatggacctggctttggacccaacttgcccaatcacaag
tcaggctcctatctcaccccttcaccatgccatgaaaattttgtagtgggggcaaacagg
gcttcccatagggcagcagcaccacctcgacttctgcccccattgccaacttgctatggg
cctctcaaagtaggaggcacaaaccccagctgtggccatcctgaggtgggcaggctagga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacacgcagctggactttgtggctattctggatgaggcccaggggctgagt
cctcctccttcccatgatcaggggggcagctctggacataccccacctccctctgggccc
cccaacatggctgtgggcaacatgagtgtcttactgagatccctacctggggaaacacaa
ttcctcaactctagtgcctga

DBGET integrated database retrieval system