KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100600519
Entry
100600519         CDS       T03265                                 

Gene name
FOXO3
Definition
(RefSeq) forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04062  Chemokine signaling pathway
nle04068  FoxO signaling pathway
nle04137  Mitophagy - animal
nle04151  PI3K-Akt signaling pathway
nle04152  AMPK signaling pathway
nle04211  Longevity regulating pathway
nle04213  Longevity regulating pathway - multiple species
nle04218  Cellular senescence
nle04722  Neurotrophin signaling pathway
nle04917  Prolactin signaling pathway
nle05213  Endometrial cancer
nle05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100600519 (FOXO3)
   04151 PI3K-Akt signaling pathway
    100600519 (FOXO3)
   04152 AMPK signaling pathway
    100600519 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100600519 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    100600519 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100600519 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100600519 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100600519 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    100600519 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    100600519 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    100600519 (FOXO3)
   05223 Non-small cell lung cancer
    100600519 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100600519 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nle03000]
    100600519 (FOXO3)
Transcription factors [BR:nle03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    100600519 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 100600519
NCBI-ProteinID: XP_003255587
Ensembl: ENSNLEG00000012446
UniProt: G1RPE6
LinkDB
Position
3
AA seq 672 aa
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPASAAGALSG
GTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGS
GLGSPASSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcaccggcctccccggccccgctctctccgctcgaagtggagctggaccca
gagttcgagccccagagccgtccgcgatcctgtacgtggcccctgcaaaggccggagctc
caagcgagccctgctaagccctcgggggagacggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcgggggacgggccggctcggccatggcgatcggc
ggcggcgggagcggcacgctgggctccgggctgctccttgaggactcggcccgggtgctg
gcacccggagggcaagaccccgggtctgggccagccagcgcggcgggcgcgctgagcggg
ggtacacaggcgctgctgcagcctcagcaacctctgccaccgccgcagccgggggcggct
gggggctccgggcagccgaggaaatgttcgtcgcggcggaacgcctggggaaacctgtcc
tacgcggacctgatcacccgcgccatcgagagctccccggacaaacggctcacgctgtcc
cagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactctatccggcacaacctgtcactgcatagtcgattcatg
cgggtccagaatgagggaactggcaagagctcttggtggatcatcaaccctgatgggggg
aagagcggaaaagccccccggcggcgggctgtctccatggacaacagcaacaagtatacc
aagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccccgaatcagct
gacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagtgat
gagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtcagt
ggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgacgatgcg
cctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtaagcaagccg
tgcacggtggaactgccgcggctgactgatatggcgggcaccatgaatctgaatgatggg
ctgactgaaaacctcatggacgacctgctagataacatcacgctgccgccatcccagcca
tcgcccactgggggactcatgcagcggagctctagcttcccgtacaccaccaagggctcg
ggcctgggctccccagccagctcctttaatagcacggtgtttggaccttcatctctgaac
tccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctcttcc
atgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagccac
agcgatgttatgatgacacagtcagaccccttgatgtctcaggccagcaccgctgtgtct
gcccagaattcccgccggaacgtgatgcttcgcaatgatccgatgatgtcctttgctgcc
cagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagtgag
tccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatgcaa
accctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgcccgtc
atgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system