KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100601700
Entry
100601700         CDS       T03265                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle01522  Endocrine resistance
nle01524  Platinum drug resistance
nle04010  MAPK signaling pathway
nle04012  ErbB signaling pathway
nle04020  Calcium signaling pathway
nle04066  HIF-1 signaling pathway
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04520  Adherens junction
nle04530  Tight junction
nle05200  Pathways in cancer
nle05205  Proteoglycans in cancer
nle05206  MicroRNAs in cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05215  Prostate cancer
nle05219  Bladder cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05226  Gastric cancer
nle05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100601700 (ERBB2)
   04012 ErbB signaling pathway
    100601700 (ERBB2)
   04066 HIF-1 signaling pathway
    100601700 (ERBB2)
   04020 Calcium signaling pathway
    100601700 (ERBB2)
   04151 PI3K-Akt signaling pathway
    100601700 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100601700 (ERBB2)
   04520 Adherens junction
    100601700 (ERBB2)
   04530 Tight junction
    100601700 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100601700 (ERBB2)
   05206 MicroRNAs in cancer
    100601700 (ERBB2)
   05205 Proteoglycans in cancer
    100601700 (ERBB2)
   05230 Central carbon metabolism in cancer
    100601700 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100601700 (ERBB2)
   05226 Gastric cancer
    100601700 (ERBB2)
   05219 Bladder cancer
    100601700 (ERBB2)
   05215 Prostate cancer
    100601700 (ERBB2)
   05213 Endometrial cancer
    100601700 (ERBB2)
   05224 Breast cancer
    100601700 (ERBB2)
   05223 Non-small cell lung cancer
    100601700 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100601700 (ERBB2)
   01524 Platinum drug resistance
    100601700 (ERBB2)
   01522 Endocrine resistance
    100601700 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100601700 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nle04147]
    100601700 (ERBB2)
   04090 CD molecules [BR:nle04090]
    100601700 (ERBB2)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100601700 (ERBB2)
Protein kinases [BR:nle01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100601700 (ERBB2)
Exosome [BR:nle04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100601700 (ERBB2)
CD molecules [BR:nle04090]
 Proteins
  100601700 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 100601700
NCBI-ProteinID: XP_030664092
Ensembl: ENSNLEG00000000989
LinkDB
Position
Unknown
AA seq 1255 aa
MELAALCGWGLLLALLPPGAASTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNG
DPLNNTTLVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLA
LTLIDTNRSRACQPCSPVCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLS
DLSVFQNLQVIRGRILHNGAYSLTLQGVGISWLGLRSLRELGSGLALIHHNNRLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVSCAHYKDPPFCVARC
PSGVKPDLSYMPIWKFPDEEGTCQPCPINCTHSCVDLDDKGCPAEQRASPLTSIISAVVG
ILLVVVLGAVFGILIKRRQQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVRENRGRLGSQDLLNWCMQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVSEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGAGGMVHHRHRSSSTRSGGGDLTLGLEPSEEEAPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQSLPAHDPSPLQRYSEDPTVPLPSETDGYVTPLTCSLQPEYV
NQPDVRPQPPSPREGPLPPARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLAPR
GGAAPQPHPPPAFSPAFDNLYYWDQDPSERGAPPSTFKGTPTAENPEYLGLDVPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggccttgtgcggctgggggctcctcctcgccctcttgccccccggagcc
gcgagcacccaagtgtgcaccggcacagacatgaagctgcggctccctgccagtcccgag
acccacctggacatgctccgccacctctaccagggctgccaggtggtgcagggaaacctg
gaactcacctacctgcccaccaatgccagcctctccttcctgcaggatatccaggaggta
cagggctacgtgctcatcgctcacaaccaagtgaggcaggtcccactgcagaggctgcgg
attgtgcgaggcacccagctctttgaggacaactatgccctggctgtgctagacaatgga
gacccgctgaacaataccacccttgtcacaggggcctccccaggaggcctgcgggagctg
cagcttcgaagcctcacagagatcttgaaaggaggggtcttgatccagcggaacccccag
ctctgctaccaggacacgattttgtggaaggatatcttccacaagaacaaccagctggct
ctcacactgatagacaccaaccgctctcgggcctgtcagccctgttctccggtgtgtaag
ggctcccgctgctggggagagagttctgaggattgtcagagcctgacgcgcactgtctgt
gctggtggctgtgcccgctgcaaggggccactgcccactgactgctgccatgagcagtgt
gctgccggctgcacgggccccaagcactctgattgcctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagccctggtcacctacaacacagacacctttgag
tccatgcccaatcccgagggccggtatacattcggcgccagctgtgtgactgcctgtccc
tacaactacctttctacggacgtgggatcctgcaccctcgtttgccccctgcacaaccaa
gaggtgacagcagaggacggaacacagcggtgtgagaagtgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggagcacttgcgagaggtgagggcagtcaccagtgccaat
atccaggagtttgctggctgcaagaagatctttgggagcctggcatttctgccggagagc
tttgatggggacccagcctccaacaccgccccgctccagccagagcagctccaagtgttt
gagactctggaagagatcacaggttacttatacatctcagcatggccagacagcctgtct
gacctcagcgtcttccagaacctgcaagtaatccggggacgaattctgcacaatggcgcc
tactcgctgaccctgcaaggggtgggcatcagctggctggggctgcgctcgctgcgggaa
ctgggcagtggactggccctcatccaccataacaaccgcctctgcttcgtgcacacggtg
ccctgggaccagctcttccggaacccgcaccaagccctgctccacactgccaaccggcca
gaggacgagtgtgtgggcgagggcctggcctgccaccagctgtgcgcccgagggcactgc
tggggtccagggcccacccagtgtgtcaactgcagccagttccttcggggccaggagtgc
gtggaggaatgccgagtactgcaggggcttcccagggagtatgtgaatgccaggcactgt
ttgccatgccaccccgagtgtcagccccagaatggctcagtgacctgttttggaccggag
gctgaccagtgtgtgtcctgtgcccactataaagaccctcccttctgcgtggcccgctgc
cccagcggtgtgaaacctgacctctcctacatgcccatctggaagtttccagatgaggag
ggcacgtgccagccttgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgctgagcagagagccagccctctgacgtccatcatctctgcggtggtgggc
atcctgctggtcgtggtcttgggggcggtctttgggatcctcatcaagcgacgacagcag
aagatccggaagtacacgatgcggaggctgctgcaggaaacggagctggtggagccgctg
acacctagcggagcgatgcccaaccaggcgcagatgcggatcctgaaagagacggagctg
aggaaggtgaaggtgcttggatctggcgcttttggcacagtctacaagggcatctggatc
cctgatggggagaatgtgaaaattccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttagacgaagcatacgtgatggctggtgtgggctcccca
tatgtttcccgcctcctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcttagaccatgtccgggaaaaccgcggacgcctgggctcccag
gacctgctgaactggtgtatgcagattgccaaggggatgagctacctggaggatgtgcgg
ctcgtacacagggacttggctgctcggaacgtgctggtcaagagtcccaaccatgtcaaa
attacagacttcgggctggctcggctgctggacattgacgagacagagtaccatgcagat
gggggcaaggtgcccatcaagtggatggcactggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagttatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctgctggaaaagggggagcgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgagattccgggagttggtgtctgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaggacttgggccctgccagtcccttg
gacagcaccttctaccgctcactgctggaggatgatgacatgggggacctggtggatgct
gaggagtatctggtaccccagcagggcttcttctgtccagaccctgccccgggtgctggg
ggcatggtccaccacaggcaccgcagctcatctaccaggagtggcggtggggacctgacg
ctagggctggagccctcagaagaggaggcccccaggtctccactggcaccctccgaaggg
gctggctccgatgtatttgatggtgacctgggaatgggggcagccaaggggctgcaaagc
ctccccgcacatgaccccagccctctacagcggtacagtgaggaccccacagtacccctg
ccctctgagactgacggctacgttacccccctgacctgcagcctccagcccgaatatgtg
aaccagccagatgttcggccacaacccccttcgccccgagagggccctctgcctcctgcc
cgacctgctggtgccactctggaaaggcccaagactctctccccagggaagaatggggtc
gtcaaagacgtttttgcctttgggggtgctgtggagaaccccgagtacttggcaccccgg
ggaggagctgcccctcagccccaccctcctccggccttcagcccagccttcgacaacctc
tattactgggaccaggacccatcagagcggggggctccacccagcaccttcaaagggaca
cctacggcagagaacccagagtacctgggtctggacgtgccagtgtga

DBGET integrated database retrieval system