KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100602907
Entry
100602907         CDS       T03265                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04024  cAMP signaling pathway
nle04340  Hedgehog signaling pathway
nle05200  Pathways in cancer
nle05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    100602907 (HHIP)
   04024 cAMP signaling pathway
    100602907 (HHIP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100602907 (HHIP)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100602907 (HHIP)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 100602907
NCBI-ProteinID: XP_003257810
Ensembl: ENSNLEG00000005430
UniProt: G1R071
LinkDB
Position
7b
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLE
LLSGGEMLCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSPHSQ
SLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEFCFYYARKDGGLCF
PDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCFCIQEVVSGLRQPVGALHSGDGSH
RLFILEKEGYVKILTPEGEIFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDLRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGKDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPVTKQWQEKPLCLGTS
GSCRGYFSGHILGFGEDELGEVYILSSSKSMTQTHNGKLYKIVDPKRPLMPEECRATVQP
AQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDFCRIAKCEPACRHGGVCVRPNKCLCKKG
YLGLQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcctttaagctgctgctgctggccgtggctctgggcttctttgaa
ggagatgctaagtttggggaaagaaacgaagggagcggagcaaggaggagaaggtgcctg
aatgggaaccccccgaagcgcctgaaaaggagagacaggaggatgatgtcccagctggag
ctgctgagtgggggagagatgctgtgcggtggcttctaccctcggctgtcctgctgcctg
cggagtgacagcccggggctggggcgcctggagaataagatattttctgttaccaacaac
acagaatgtgggaagttactggaggaaatcaaatgtgcactttgctctccacattctcaa
agcctgttccactcacctgagagagaagtcttggaaagagacctagtacttcctctgctc
tgcaaagactattgcaaagaattcttttacacttgccgaggccatattccaggtttcctt
caaacaactgcggatgagttttgcttttactatgcaagaaaagatggtgggttgtgcttt
ccagattttccaagaaaacaagtcagaggaccagcatctaactatttggaccagatggaa
gaatatgacaaagtggaagagatcagcagaaagcacaaacacaactgcttctgtattcag
gaggttgtgagtgggctgcggcagcccgttggtgccctgcatagtggggatggctcgcac
cgtctcttcattctggaaaaagaaggttatgtgaagatacttacccctgaaggagaaatt
ttcaaggagccttatttggacattcacaaacttgttcaaagtggaataaagggaggagat
gaaagaggactgctaagcctcgcattccatcccaattacaagaaaaatggaaagttgtat
gtgtcttataccaccaaccaagaacggtgggctattgggcctcatgaccacattcttagg
gttgtggaatacacagtatccagaaaaaatccacaccaagttgatttgagaacagccaga
gtctttcttgaagttgcagaactccacagaaagcatctgggaggacaactgctctttggc
cctgacggctttttgtacatcattctcggtgatgggatgattaccctggatgatatggaa
gaaatggatgggttaagtgatttcacaggctcagtgctacggctggatgtggacacagac
atgtgcaacgtgccttattccataccaaggagcaacccacacttcaacagcaccaaccag
ccccccgaagtgtttgctcatgggctccacgatccaggcagatgtgctgtggatcgacat
cccaccgacataaacatcaatttaacgatactttgttcagactccaatggaaaaaacaga
tcatcagccagaatcctacagataataaaggggaaagattacgaaagtgagccatcactt
ttagaattcaagccattcagtaatggtcctttggttggtggatttgtataccggggctgc
cagtcagaaagattgtatggaagctatgtgtttggagatcgtaatgggaatttcttaact
ctccagcaaagtcctgtgacaaagcaatggcaagaaaaaccactctgtctcggcactagt
gggtcctgtagaggctacttttccggtcacatcttgggatttggagaagatgaactaggt
gaagtttacattttatcaagcagtaaaagtatgacccagactcacaatggaaaactctac
aaaattgtagatcccaaaagacctttaatgcctgaggaatgcagagccacggttcaacct
gcacagacactgacttcagagtgctccaggctctgtcgaaacggctactgcacccccacg
ggaaagtgctgctgcagtccaggctgggagggggacttctgcagaattgcaaaatgtgag
ccagcatgtcgtcatggaggtgtctgtgttagaccgaacaagtgcctctgtaaaaaagga
tatcttggtcttcaatgtgaacaagtggacagaaacatccgcagagtgaccagggcaggt
attcttgatcagatcattgacatgacatcttacttgctggatctaacaagttacattgta
tag

DBGET integrated database retrieval system