KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100603207
Entry
100603207         CDS       T03265                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle01521  EGFR tyrosine kinase inhibitor resistance
nle04010  MAPK signaling pathway
nle04014  Ras signaling pathway
nle04015  Rap1 signaling pathway
nle04020  Calcium signaling pathway
nle04072  Phospholipase D signaling pathway
nle04144  Endocytosis
nle04151  PI3K-Akt signaling pathway
nle04510  Focal adhesion
nle04540  Gap junction
nle04630  JAK-STAT signaling pathway
nle04810  Regulation of actin cytoskeleton
nle05163  Human cytomegalovirus infection
nle05200  Pathways in cancer
nle05206  MicroRNAs in cancer
nle05214  Glioma
nle05215  Prostate cancer
nle05218  Melanoma
nle05230  Central carbon metabolism in cancer
nle05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100603207 (PDGFRA)
   04014 Ras signaling pathway
    100603207 (PDGFRA)
   04015 Rap1 signaling pathway
    100603207 (PDGFRA)
   04630 JAK-STAT signaling pathway
    100603207 (PDGFRA)
   04020 Calcium signaling pathway
    100603207 (PDGFRA)
   04072 Phospholipase D signaling pathway
    100603207 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    100603207 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100603207 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100603207 (PDGFRA)
   04540 Gap junction
    100603207 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100603207 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100603207 (PDGFRA)
   05206 MicroRNAs in cancer
    100603207 (PDGFRA)
   05230 Central carbon metabolism in cancer
    100603207 (PDGFRA)
   05231 Choline metabolism in cancer
    100603207 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    100603207 (PDGFRA)
   05218 Melanoma
    100603207 (PDGFRA)
   05215 Prostate cancer
    100603207 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100603207 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100603207 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nle01001]
    100603207 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:nle04090]
    100603207 (PDGFRA)
Enzymes [BR:nle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100603207 (PDGFRA)
Protein kinases [BR:nle01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100603207 (PDGFRA)
CD molecules [BR:nle04090]
 Proteins
  100603207 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 100603207
NCBI-ProteinID: XP_030674789
Ensembl: ENSNLEG00000008285
LinkDB
Position
9
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTEENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLRNSEGVVPASYNSRQGFNG
TFTVGPYTCEAIVKGKKFQTIAFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVQAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMT
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTCKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggtcgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaactccgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgt
tattacaaccacactcagacagaagagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacggattatttagtcatcgtg
gaggacgatgattctgccatcataccttgtcgcacaactgatcccgagacccctgtaacc
ttacgcaacagtgagggggtggtacctgcctcctacaacagcagacagggctttaatggg
acattcactgtagggccctatacctgtgaggccatcgtcaaaggaaagaagttccagacc
atcgcatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgttttcaacaat
gaggtggttgaccttcaatggacgtaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaagtcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacctacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcag
gcctacccacctcccaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgacgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggactta
gtcgatgatcaccatggctcaactgggggacagacagtgaggtgcacagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaggatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaatatcatcacggagatccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccattgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgctggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagggatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacggagtactgcttctacgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctagct
agagacatcatgcatgattcgaactacgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgacg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcgtacattggtgtcacctgcaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agttcgcagacctctgaagagagcgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggatgacatcgggatagactct
tcagacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system