KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100605065
Entry
100605065         CDS       T03265                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle03420  Nucleotide excision repair
nle04115  p53 signaling pathway
nle04120  Ubiquitin mediated proteolysis
nle05161  Hepatitis B
nle05169  Epstein-Barr virus infection
nle05200  Pathways in cancer
nle05202  Transcriptional misregulation in cancer
nle05210  Colorectal cancer
nle05212  Pancreatic cancer
nle05213  Endometrial cancer
nle05214  Glioma
nle05216  Thyroid cancer
nle05217  Basal cell carcinoma
nle05218  Melanoma
nle05220  Chronic myeloid leukemia
nle05222  Small cell lung cancer
nle05223  Non-small cell lung cancer
nle05224  Breast cancer
nle05225  Hepatocellular carcinoma
nle05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:nle00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100605065 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100605065 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100605065 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100605065 (DDB2)
   05202 Transcriptional misregulation in cancer
    100605065 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100605065 (DDB2)
   05212 Pancreatic cancer
    100605065 (DDB2)
   05225 Hepatocellular carcinoma
    100605065 (DDB2)
   05226 Gastric cancer
    100605065 (DDB2)
   05214 Glioma
    100605065 (DDB2)
   05216 Thyroid cancer
    100605065 (DDB2)
   05220 Chronic myeloid leukemia
    100605065 (DDB2)
   05217 Basal cell carcinoma
    100605065 (DDB2)
   05218 Melanoma
    100605065 (DDB2)
   05213 Endometrial cancer
    100605065 (DDB2)
   05224 Breast cancer
    100605065 (DDB2)
   05222 Small cell lung cancer
    100605065 (DDB2)
   05223 Non-small cell lung cancer
    100605065 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100605065 (DDB2)
   05169 Epstein-Barr virus infection
    100605065 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nle04121]
    100605065 (DDB2)
   03400 DNA repair and recombination proteins [BR:nle03400]
    100605065 (DDB2)
Ubiquitin system [BR:nle04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100605065 (DDB2)
DNA repair and recombination proteins [BR:nle03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100605065 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 100605065
NCBI-ProteinID: XP_030650444
Ensembl: ENSNLEG00000014385
LinkDB
Position
15
AA seq 455 aa
MAPKKRPETQKTSEIVLRPRNKRSRSPRELEPEAKKLCAKGSGPSRRCDSDCLWAGLAGP
QILPPCRSIVRTLHEHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFTSSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKEVRSPRS
CLSLPHPCLGSVSPPEPSSFLQLWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDL
RQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQWDCPLGLIPHPHR
HFQHLTPIKAAWHPRYNLIVVGRYPDPNFKSCTPYELRTIDVFDGNSGKMMCQLYDPESS
GISSLNEFNPMGDTLASAMGYHVLIWSQEEARTRK
NT seq 1368 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgtcccagg
aacaagaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggcggggctggctggcccg
cagatcctgccaccatgccgcagcatcgtcaggaccctccatgagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttctgcacactctggattct
taccggatattgcaaaaggctgccccctttgacaggagggctacatccttggcgtggcac
ccgactcaccccagcactgtagctgtgggttccaaagggggagatatcatgctgtggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttaccagctcagacaccatc
aacatctggttttgtagcctagatgtgtctgctagtagccgaatggtggtgacaggagac
aacgtggggaacgtgatcctgctgaacatggatggcaaagaggtgcgttctccgaggtcc
tgcctttccctccctcacccctgcctcggttctgtgtccccacctgaaccgagctctttt
ctgcagctttggaatctcagaatgcacaaaaagaaagtgacgcatgtggccctgaaccca
tgctgtgattggttcctggccacagcctccgtagatcaaacagtgaaaatttgggacctg
cgccaggttagagggaaagccagcttcctctactcgctgccgcacaggcatcctgtcaac
gcagcttgtttcagccccgatggagcccggctcctgaccacagaccagaagagcgagatc
cgagtttactccgcttcccagtgggactgccccctgggcctgatcccgcaccctcaccgt
cacttccagcacctcacacccatcaaggcagcctggcatcctcgctacaacctcattgtc
gtgggccgatacccagatcctaatttcaaaagttgtaccccttatgaattgaggacaatc
gatgtgttcgatggaaactcagggaagatgatgtgtcagctctatgacccagaatcttct
ggcatcagttcgcttaatgagttcaatcccatgggggacacgctggcctctgcaatgggt
taccacgttctcatctggagccaggaggaagccaggacacggaaatga

DBGET integrated database retrieval system