KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 105739944
Entry
105739944         CDS       T03265                                 

Gene name
AP3S2
Definition
(RefSeq) AP-3 complex subunit sigma-2
  KO
K12399  AP-3 complex subunit sigma
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nle00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105739944 (AP3S2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nle04131]
    105739944 (AP3S2)
Membrane trafficking [BR:nle04131]
 Endosome - Lysosome transport
  Others
   AP-3 complex
    105739944 (AP3S2)
 Endosome - Golgi transport
    105739944 (AP3S2)
SSDB
Motif
Pfam: Clat_adaptor_s
Other DBs
NCBI-GeneID: 105739944
NCBI-ProteinID: XP_030670873
LinkDB
Position
6
AA seq 193 aa
MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSD
YKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYIL
QEVVMGGMVLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIG
DLNIKVPNLSQFV
NT seq 582 nt   +upstreamnt  +downstreamnt
atgattcaggcgattctggttttcaacaaccatgggaagccgcggctagtccgcttctac
cagcgtttcccagaagaaattcaacagcagattgttcgagagactttccatctagtcctc
aagcgggatgacaacatctgtaacttcttggagggtggaagtttgattggtggctctgac
tacaaactgatctaccggcactatgctaccctctactttgtattttgtgtggattcgtca
gagagtgaacttggaatcttggacctcatacaggtttttgtggaaactctggataagtgt
ttcgaaaatgtgtgtgaattggatttgatcttccatatggataaggtgcactacatcctc
caggaggtggtgatgggtgggatggtgttggaaacaaacatgaatgaaatcgtggctcag
attgaagctcagaacaggctggagaaatccgagggtggcctttcagcagcccctgcgcgg
gctgtgtctgctgtgaaaaacatcaacctgccagagattcctcggaacatcaacattggc
gatctcaacatcaaagttcccaacctgtcccagtttgtctga

DBGET integrated database retrieval system