KEGG   Numida meleagris (helmeted guineafowl): 110393465
Entry
110393465         CDS       T06015                                 

Gene name
TGFBR2
Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
nmel  Numida meleagris (helmeted guineafowl)
Pathway
nmel04010  MAPK signaling pathway
nmel04060  Cytokine-cytokine receptor interaction
nmel04068  FoxO signaling pathway
nmel04144  Endocytosis
nmel04218  Cellular senescence
nmel04350  TGF-beta signaling pathway
nmel04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:nmel00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110393465 (TGFBR2)
   04350 TGF-beta signaling pathway
    110393465 (TGFBR2)
   04068 FoxO signaling pathway
    110393465 (TGFBR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110393465 (TGFBR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110393465 (TGFBR2)
  09143 Cell growth and death
   04218 Cellular senescence
    110393465 (TGFBR2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110393465 (TGFBR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nmel01001]
    110393465 (TGFBR2)
Enzymes [BR:nmel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110393465 (TGFBR2)
Protein kinases [BR:nmel01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110393465 (TGFBR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal APH
Other DBs
NCBI-GeneID: 110393465
NCBI-ProteinID: XP_021242034
LinkDB
Position
2
AA seq 456 aa
MPPRLRPLLLRVSLWVLVGSSSPALLPGTGEECNDVLIFSADPHKPEEKDEISKVTIISL
VPLLVISVAVIVIFYAYRTHKKRKLSKAWEKNVKPRKHKDCSDVCAIMLDDDHSDISSTC
ANNINHNTELLPIELDIVVGKGRFAEVYKAKLKQNTSEQYETVAVKIFPYEEYASWKTEK
DIFSDVNLKHENILQFLTAEERKTDLGKQYWLITAFHARGNLQEYLTRHIISWEDLWKLG
GSLARGIAHLHSDHTPCGRPKTPIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPSLSVD
DLANSGQVGTARYMAPEVLESRMNLENMESFKQTDVYSMALVLWEMTSRCNGVGEVKEYE
PPFGSKVREHPCVESMKDNVLRDRGRPEIPSSWLNHQGIQMVCETLIECWDHDPEARLTA
QCVAERFSELKHHDKLSGRSCSEEKIPEDGSVTTAK
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcctccgcgcctgcggccgctgctcctgcgcgtgtccctgtgggtcctcgtgggctcc
tcgagccccgcgctgctccccggtacaggtgaagagtgcaacgatgttcttattttttct
gcagatccccataagccagaggagaaagatgaaatttccaaagtcacaatcataagtctt
gtccccttactggtgatttctgttgctgtgattgttatcttttatgcctaccgcactcat
aagaagaggaagctcagcaaggcctgggagaagaacgttaagcccaggaagcataaagac
tgcagtgatgtttgtgccattatgttggatgatgaccactcagacatcagctctacctgt
gccaacaacatcaaccacaacacagaattgctgcccattgagctggacattgttgttggc
aaaggaaggtttgctgaagtgtataaagccaaactgaagcaaaacacatctgagcagtac
gaaactgtggcagtaaagatcttcccctacgaagaatatgcctcctggaaaaccgagaaa
gacattttttcagatgtaaaccttaagcatgagaacatcctccagttcttgacagcagag
gagcgtaagacagatcttggcaaacagtattggttgatcactgccttccatgctagagga
aacttgcaggaatacctcacacgacacattatcagctgggaagacctctggaaactggga
gggtccttggcccgagggattgcccatctgcacagtgatcacacaccctgtggtcgccct
aaaacccctattgtgcacagagacctaaagagttccaacatcctggtgaaaaatgattta
acttgctgtctctgtgactttgggttatccctgaggctggacccttctctttctgtggat
gacttggccaacagcggtcaggttggcacagctaggtacatggcccctgaggtcctggag
tccaggatgaacctagagaacatggagtcctttaaacaaacagatgtgtactccatggct
ttggtcctctgggaaatgacatctcgctgtaatggtgttggagaagtgaaagaatatgag
cccccattcggctctaaagtgcgagaacatccctgcgtggaaagcatgaaggacaatgtc
ctaagagacagagggcgacccgagatccccagctcctggcttaaccatcagggcatccag
atggtgtgcgagacccttatcgagtgctgggaccacgaccccgaggcccggctcacagcg
cagtgcgtggcggagcgcttcagcgagctcaagcaccacgacaagctctcagggagaagc
tgttcagaggagaagatccccgaggacggttccgtaaccaccgccaagtag

DBGET integrated database retrieval system