Numida meleagris (helmeted guineafowl): 110400875 Help Entry 110400875         CDS       T06015                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism nmel  Numida meleagris (helmeted guineafowl) Pathway nmel03030   DNA replication nmel03410   Base excision repair nmel03420   Nucleotide excision repair nmel03430   Mismatch repair nmel03440   Homologous recombination Brite KEGG Orthology (KO) [BR:nmel00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     110400875 (POLD4)    03410 Base excision repair     110400875 (POLD4)    03420 Nucleotide excision repair     110400875 (POLD4)    03430 Mismatch repair     110400875 (POLD4)    03440 Homologous recombination     110400875 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:nmel03032]     110400875 (POLD4)    03400 DNA repair and recombination proteins [BR:nmel03400]     110400875 (POLD4) DNA replication proteins [BR:nmel03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     110400875 (POLD4) DNA repair and recombination proteins [BR:nmel03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       110400875 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      110400875 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  110400875 NCBI-ProteinID:  XP_021256879 LinkDB All DBs Position 6:complement(1362173..1362528) Genome browser AA seq 129 aa AA seqDB search MERGGRITDCFPRRHRARTRAAGKERRAARSGKRRGIPVAPPPRPSPPSPAQEEPPRDPP PAASRELLEMLRRFDLAWEYGPCTGITRLQRWERAQALGLSPPAPVREALLEHRDDPAVT YSLWHEYGL NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atggagcgcggcgggcggatcaccgactgcttcccgcggagacaccgggcgcggacccgc gccgcgggcaaagagcgaagagcggcgcggagcggaaagcgccgggggatcccggtagcc ccgcccccgcggccctctccccccagccccgcgcaggaggagccgccccgggatcccccc cccgccgcttcccgcgagctgctggagatgctgcggcgcttcgacctggcctgggagtac gggccctgcaccggcatcacccggctgcagcgctgggagcgggcgcaggcgctggggctc agcccgccggccccggtccgcgaggcgctgctggagcaccgcgacgaccccgccgtcacc tacagcctgtggcacgagtacggcctctga

DBGET integrated database retrieval system