KEGG   Nipponia nippon (crested ibis): 104008993
Entry
104008993         CDS       T05756                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04012  ErbB signaling pathway
nni04136  Autophagy - other
nni04140  Autophagy - animal
nni04150  mTOR signaling pathway
nni04218  Cellular senescence
nni04371  Apelin signaling pathway
nni04910  Insulin signaling pathway
nni04920  Adipocytokine signaling pathway
nni05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    104008993 (MTOR)
   04371 Apelin signaling pathway
    104008993 (MTOR)
   04150 mTOR signaling pathway
    104008993 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104008993 (MTOR)
   04136 Autophagy - other
    104008993 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    104008993 (MTOR)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    104008993 (MTOR)
   04920 Adipocytokine signaling pathway
    104008993 (MTOR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    104008993 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nni01001]
    104008993 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104008993 (MTOR)
Enzymes [BR:nni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     104008993 (MTOR)
Protein kinases [BR:nni01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   104008993 (MTOR)
Membrane trafficking [BR:nni04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    104008993 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 IFRD HEAT_EZ EPSP_synthase UME CFIA_Pcf11 Nipped-B_C
Other DBs
NCBI-GeneID: 104008993
NCBI-ProteinID: XP_009459220
LinkDB
Position
Unknown
AA seq 2521 aa
MSGTVSILQQFANGLKSRSEETRAKAAKDLQHYVTMELREMSQEESTRFYDQLNHHIFEL
VSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDPVVMEMASKAIGRLA
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNI
FVAVWDPKQAIREGAVSALRACLILTTQREPKEMQKPQWYRHTYEEAEKGFDETLAKEKG
MNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYCKDLMGFSTKPRHIT
PFTSFQSLQPSQSNALAGLLGYSAHQGIMGFATSPVPAKSTLVESRCCRDLMEEKFDQVC
QWVLKCRTSKNSLIQMTVLNLLPRLAAFRPSAFTADQYLPDTMNHVLSCVKKEKERTAAF
QALGLLSVAVRSEFQAYLPKVLEIIKAALPPKDFAHKRQKSVQVDATVFTCISMLARAMG
PSIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRH
PGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSE
HKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLLVVGITDPDPDIRFC
VLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKML
IQILTELEHSGVGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALIVKLKDPDPDPNPGV
INNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVALWTLGQLVASTGYV
VEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASA
VSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSQHHTMVVQA
ITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVRSHIRPYMDEI
VTLMRDFWVMNNSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSQSRIVSV
KLLNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPVVARKAALETVDRLTESLDFTDYASR
IIHPIVRTLDQSPELRTTAMDTLSSLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLIC
RIVKGYTLADEEEDPLIYQHRMLRSNQGETLASGPVETGPMKKLHVSTINLQKAWGAARR
VSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSCWSELNEDQQ
DELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYA
KALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHFGELEIQATWYEKLH
EWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEKWTQVNDETQAKMAR
MAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAE
LTAMAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERREIIRQIWWERLQGCQRIVEDWQ
RILMVRSLVVNPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSRQLDHPLPTVHP
QVTYAYMKHMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKL
GEWQLNLQGINESTIPKVLQYYSAATEHDRNWYKAWHAWAVMNFEAVLHYKHQNQARDEK
KKLRHASGASITSANTEGSNSESDAESTENSPIPSPVQKKVTEDLSKTLLMYTVPAVQGF
SRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDT
PRPLVGRLIHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQ
AMMVSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKET
SFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSP
KLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQVITSKQRPRKLTLMGSNGHEFVFLLKG
HEDLRQDERVMQLFGLVNTLLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHA
LIRDYREKKKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWLKSP
SSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTR
EKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHKDSVMAVLEAFVYDPLLN
WRLMDTNTKGNKRSRTRTDSYSASQSVEMLDSVELGETAHKKTGTTVPESIHSFIGDGLV
KPEALNKKAIQIINRVRDKLTGRDFSHDETLDVPTQVELLIKQATSHENLCQCYIGWCPF
W
NT seq 7566 nt   +upstreamnt  +downstreamnt
atgtcgggcactgtgtccattctccagcaatttgccaatggcttgaagagtcgcagtgaa
gagacgagggcaaaagctgccaaggacttgcagcattatgtcaccatggagctccgtgaa
atgagtcaagaggaatctacaaggttttatgatcagctgaaccatcacatatttgagctg
gtctctagctctgatgcaaatgaaaggaagggtggcattctggctatagcaagccttatc
ggtgttgaaggaggtaacgccacccgtatcggcaggtttgccaactacctgaggaacctc
ttgccgtccaacgaccctgttgtaatggagatggcctccaaggctatcgggcggcttgcg
atggctggtgacacgttcacagctgagtatgtggagtttgaggtgaaacgagctctggaa
tggctgggagctgacaggaatgaaggtcgaagacatgcagctgttcttgtcctgcgtgag
ctggcaatcagcgtgcctaccttcttcttccaacaagtgcagccgttctttgacaatata
tttgtggctgtgtgggatcccaaacaggccatccgagagggagctgtttctgccttaaga
gcctgccttatcctcaccactcaacgggagccaaaagagatgcagaagccccagtggtac
agacatacatatgaagaggctgagaagggctttgatgagactttggccaaagagaaagga
atgaaccgtgatgaccgaatccatggtgccttactgatcctcaatgagctagtgagaatc
agcagtatggagggagagcgccttagagaggagatggaagagatcactcagcagcagctt
gtgcacgacaagtactgcaaagacctgatgggcttcagtaccaaacctcgccacatcact
cccttcactagcttccagtctcttcagccctctcagtcaaatgctttggctggtcttctg
gggtacagtgcccaccaaggaatcatgggttttgcaacctcacctgtcccagcaaagtct
acattggtagaaagtcgatgctgcagggatctaatggaagagaagtttgatcaagtgtgc
cagtgggttctcaagtgcagaaccagcaaaaattctttgatccagatgacggttctcaat
ctgctaccacggctggcagctttccgtccttcagcattcacagctgatcagtatcttcca
gacaccatgaatcatgttctcagctgtgtgaagaaggagaaggagagaacagcagccttc
caagccttgggtttgctttctgtggctgtgaggtctgagtttcaagcttacctgccaaaa
gtccttgaaatcataaaagcagctcttccaccaaaggactttgcccacaagaggcagaag
tctgtgcaggttgatgccacagtcttcacctgcattagtatgctggcacgagccatggga
cccagtatccagcaggacatcaaagagcttttggaacctatgctggctgttggcctgagc
cctgctctaacagctgtgctgtacgacttgagtcgtcagatcccccagctaaagaaggat
atccaggatgggctgctgaaaatgctctcccttgttctaatgcacaagcctctgcgacat
ccaggcatgccaaagggccttgcccatcagcttgcctcccctagcctcaccaacatccca
gaagccagtgatgtgggtagcatcacccttgcccttcgtacactgggtagctttgagttt
gaaggccactctttgactcagtttgttcggcactgtgcagaccactttctgaacagtgaa
cacaaggagatccgaatggaagcagcccgcacttgttctcgcttgctcacgccttccatc
cacttgatcagtggtcatgcccatgtggtcagtcagacggcagtgcaggttgtggctgac
gtcctcagcaaactgcttgtggttggaataaccgacccagaccctgatatacgtttctgt
gtattggcttctctggatgagcgatttgatgctcaccttgcccaggcggaaaatttacaa
gctctttttgtggccctgaatgatcaagtatttgaaatccgagagctggccatctgtact
gtgggacgcctgagcagcatgaaccctgcttttgtcatgcctttcctgcgcaagatgtta
atccagattctaacagagctggaacacagtggtgttggcaggattaaagagcaaagtgcc
aggatgttgggtcacctggtttctaatgctccacgcctcattcgtccatatatggagcct
attcttaaggcactgattgtgaaactgaaagatcctgatccagatccaaatccaggggtg
attaacaatgtcctagctaccataggggagcttgcacaggtcagtgggctggagatgagg
aagtgggtggatgagctctttattataattatggacatgctgcaggactcctccctgctg
gctaaaagacaagtggctctttggacactgggacagcttgtggccagtactggttatgtg
gtggaaccatacaggaagtacccaactttgctggaggtgcttctgaacttcctgaagact
gagcagaaccagggcacccgtagagaggctattcgtgtgttagggttactgggtgctttg
gacccctacaaacacaaagtgaacattgggatgattgatcagtcacgagatgcttcagct
gtcagcctctcggagtccaaatccagccaggattcttcggactacagtaccagtgagatg
ttggtgaacatgggaaacctccctctggatgagttctatccagctgtctctatggtggca
ctgatgagaattttccgagaccaatccttgtcccaacaccacactatggtagttcaagcc
atcacctttattttcaaatctcttgggctgaagtgtgtgcagttcctgccccaggtcatg
ccaacgttccttaatgtaatacgggtttgtgatggtgccatccgagagttcctgttccag
cagctagggatgttggtgtcctttgtgagaagtcacattcgtccctatatggatgaaatt
gtcaccctgatgagagacttctgggtcatgaacaactccatacagagcacaattatccta
cttatcgagcaaattgtcgtagctctaggaggcgaattcaaactttatctgcctcagctc
attcctcacatgttacgggtcttcatgcatgacaatagtcagagtcgcattgtctctgtc
aagctactgaatgcgatccagctctttggagctaacctggatgactaccttcatttgtta
ctacctcccattgtaaagctatttgatgccccagatgtcccagtggtggctcgcaaagct
gctctggaaacagtggaccgcttgacagagtccctggatttcactgattatgcttcacgg
attattcatcctattgtgcgaacactagatcagagccctgagctacgaacaactgcgatg
gacaccctctcctctctggtgttccagctgggaaagaagtaccagatttttatcccgatg
gtgaacaaagttctggtgcgacacaggattaaccatcaacgctatgatgttcttatctgc
agaattgtaaagggctatactcttgctgatgaagaagaggatcccctgatttatcagcac
cgaatgttgagaagcaaccagggagaaactttggccagtggtcctgtggaaacaggtccc
atgaagaaattgcatgttagcaccatcaacctgcagaaggcctggggagcagcaagaaga
gtttccaaagatgactggttggaatggttaagaagactgagtttggagctactgaaagat
tcctcctcaccatccttgcgctcatgctgggccctggctcaggcatataatcccatggct
cgagatctcttcaatgctgcttttgtttcatgctggtctgaactgaatgaagaccagcag
gatgagctgatccgaagcattgaattggccctgacctctcaggacattgcagaagtcact
cagacactgctgaacttggcagaattcatggaacacagtgacaagggtccactgcctttg
agagatgataatggcattgtcctcctgggggaaagagctgcaaaatgtcgagcatatgcc
aaggcccttcactacaaggagctggaatttcaaaagggtcccaccccggccattctagag
tctctcatcagcattaacaataaactgcaacagccagaagcagctgctggggtactggaa
tatgccatgaagcactttggggagctggaaattcaagctacctggtatgaaaagcttcat
gaatgggaagatgctctggtggcctatgacaagaagatggacacaaataaagatgatcct
gagctgatgctaggacggatgcgttgcttggaagcacttggtgaatgggggcagctccac
cagcaatgctgtgaaaagtggacacaggtcaatgatgaaactcaagctaagatggctagg
atggctgctgctgctgcctggggtctgggtcagtgggacagcatggaagaatatacctgc
atgattcctagggacacccatgatggtgctttctacagggctgtactggctcttcatcag
gaccttttctcgctggctcagcagtgcattgacaaagccagagatctgctagatgctgag
ctgactgccatggcaggagagagctacagtcgagcctacggggctatggtatcctgccag
atgctgtcagagctggaagaggttatccagtataaacttgtaccagaacgccgtgagatc
atccgccagatctggtgggaaagactgcagggctgccaacgaattgtggaagactggcaa
agaatattgatggtccgatctcttgttgtgaatcctcatgaggacatgagaacttggctc
aagtatgccagcttgtgtggcaagagtgggagactggctttggcccataagacacttgtc
ctgctcttgggagtagatccatctcgacagctggatcacccactgccaacagtacatccc
caagtgacttatgcgtacatgaaacacatgtggaagagtgcccgcaagattgatgcgttc
cagcacatgcagcacttcgtgcagacaatgcagcagcaggcacagcatgctattgcaact
gaggaccagcagcacaagcaggaactccacaagctcatggcacggtgtttcctgaaactg
ggtgagtggcagctaaacctgcaaggcatcaacgagagtaccatccccaaagtcttgcaa
tactacagtgctgcaacagagcatgatcgcaactggtacaaggcctggcatgcctgggca
gtgatgaactttgaagcagtgcttcactacaagcaccaaaatcaggccagagatgaaaag
aagaaactacgtcatgccagtggagccagcatcaccagcgctaacactgagggcagtaat
agtgagagtgatgcagagagcacggagaacagtccgatcccatctccagtgcagaaaaaa
gtcactgaggatttatccaaaaccctcttgatgtacacagtccctgctgtccagggtttc
tcccgatccatatctctgtctcgaggaaacaacctgcaagacactctgagagtccttact
ctgtggtttgactatggtcactggcctgatgtgaatgaggctttggtagaaggagtcaag
gcgatccaaatagatacttggctgcaggttatccctcagctcattgcaagaattgacacc
cctcgaccattagtaggacgtctcattcatcagctcctcacagatattggacggtatcat
ccccaggctttgatctatcctttgactgtggcctctaaatctacaacaactgctcgccac
aacgctgcaaataagatcttgaaaaacatgtgcgagcacagtaacactctggtgcagcag
gcaatgatggtgagtgaagagctaatccgtgtagccatcctatggcatgagatgtggcat
gaaggattggaagaagcatctcgtctatactttggagaaaggaatgtgaagggaatgttt
gaggtgctggaaccacttcatgcaatgatggagcgtgggcctcagactttaaaagagaca
tccttcaatcaggcctatggcagagatctaatggaagctcaggaatggtgcaggaagtac
atgaaatcaggaaatgtcaaagacctaacgcaggcttgggatctctattaccatgtgttc
cggcgtatctcaaagcagctgcctcagctcacttcattggaactacagtacgtgtcacca
aaactcttaatgtgccgggacctggaattggcagtgccaggaacgtacgatcccaaccag
cccatcatacgcattcagtccattgcaccctcgctgcaggtcatcacctccaagcagcgg
cccaggaagttaacattaatgggaagcaatgggcatgagtttgtgttccttctgaaaggt
cacgaagaccttcgccaagatgagagagtgatgcagctttttgggttggtcaacactctg
ctagcaaatgacccaacttctcttcgtaaaaacctcagcatccagagatatgctgttatt
ccactgtctacaaattcaggcttgattggttgggttccccactgtgacacactgcatgct
ctcatccgagactacagagagaagaaaaagatcctgctcaacattgaacatcgcatcatg
ctgaggatggctccagattatgaccacctgactctgatgcagaaagtagaagtatttgaa
catgctgtcaataacacagctggtgatgaccttgccaaactgctgtggttgaaaagtcca
agctcggaggtgtggtttgacagaagaacaaactacactcgttcattagctgtaatgtca
atggttgggtacattttgggccttggggacagacacccctccaatctgatgttagacaga
ctgagtggaaagatcctgcatatcgactttggggactgttttgaggttgcaatgacaaga
gagaagttccctgagaagattccatttaggttaacaaggatgctgacaaatgctatggag
gtgacaggcctcgatggcaattacagaatcacctgtcacacggtgatggaagtcctgcgt
gaacataaggacagcgtcatggctgtgcttgaagcctttgtgtatgatccattgttgaat
tggcggctgatggacacaaatacaaagggcaataagcgctcacgaacaagaacagactcc
tactcagctagtcagtcagtagaaatgttggacagtgtggaattgggtgagacagcccat
aagaaaactgggaccacagtgcctgaatccatccattccttcataggagatggtctagtg
aagccagaagctctaaacaagaaggcaattcaaatcatcaacagggttcgagataagctc
actggtcgagacttctctcatgatgaaactcttgatgtacccacacaagtagaattgctc
attaagcaagctacttctcatgagaatctgtgccagtgctacattggatggtgtcctttc
tggtaa

DBGET integrated database retrieval system