KEGG   Nipponia nippon (crested ibis): 104013239
Entry
104013239         CDS       T05756                                 

Gene name
GABARAPL1
Definition
(RefSeq) gamma-aminobutyric acid receptor-associated protein-like 1
  KO
K08341  GABA(A) receptor-associated protein
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04068  FoxO signaling pathway
nni04136  Autophagy - other
nni04137  Mitophagy - animal
nni04140  Autophagy - animal
nni04371  Apelin signaling pathway
nni04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104013239 (GABARAPL1)
   04068 FoxO signaling pathway
    104013239 (GABARAPL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    104013239 (GABARAPL1)
   04136 Autophagy - other
    104013239 (GABARAPL1)
   04137 Mitophagy - animal
    104013239 (GABARAPL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    104013239 (GABARAPL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nni04131]
    104013239 (GABARAPL1)
   04121 Ubiquitin system [BR:nni04121]
    104013239 (GABARAPL1)
   03029 Mitochondrial biogenesis [BR:nni03029]
    104013239 (GABARAPL1)
Membrane trafficking [BR:nni04131]
 Autophagy
  Autophagosome formation proteins
   Atg8 conjugation proteins
    104013239 (GABARAPL1)
Ubiquitin system [BR:nni04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   104013239 (GABARAPL1)
Mitochondrial biogenesis [BR:nni03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    104013239 (GABARAPL1)
SSDB
Motif
Pfam: Atg8 APG12 VitD-bind_III
Other DBs
NCBI-GeneID: 104013239
NCBI-ProteinID: XP_009463995
LinkDB
Position
Unknown
AA seq 117 aa
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQF
YFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK
NT seq 354 nt   +upstreamnt  +downstreamnt
atgaagttccagtacaaggaagaccacccgttcgagtacaggaaaaaagaaggggagaaa
atccgcaagaaatatcccgacagagtccctgtgatcgtggaaaaagcaccaaaagccaga
gtacccgacctagacaaaaggaagtatcttgtgccttctgacctcacagttggccagttc
tacttcttaatccgaaagcggatccacctgaggccagaagatgccctgttcttctttgtc
aataacaccatccctcctaccagtgctaccatgggccagctgtatgaggataaccacgag
gaggactattttctctatgtggcctacagcgacgagagtgtctatggcaagtga

DBGET integrated database retrieval system