KEGG   Nipponia nippon (crested ibis): 104017832
Entry
104017832         CDS       T05756                                 

Gene name
SLC9A1
Definition
(RefSeq) sodium/hydrogen exchanger 1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
nni  Nipponia nippon (crested ibis)
Pathway
nni04260  Cardiac muscle contraction
nni04261  Adrenergic signaling in cardiomyocytes
nni04371  Apelin signaling pathway
nni04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:nni00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    104017832 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    104017832 (SLC9A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    104017832 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    104017832 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nni01009]
    104017832 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nni02000]
    104017832 (SLC9A1)
Protein phosphatases and associated proteins [BR:nni01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     104017832 (SLC9A1)
Transporters [BR:nni02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   104017832 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 104017832
NCBI-ProteinID: XP_009469183
LinkDB
Position
Unknown
AA seq 776 aa
MLTSEPPQGQPAQPPRAEIGGFTPAPPASAQEIQPLNKQPANGSGEGHAKPRKAFPVLAI
DYDHIRIPFEISLWILLACLMKLGFHVIPSVSNIVPESCLLIVVGLLVGGLIKGVGEKPP
ILKSDIFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTVWNAFFLGGLMYAVCQL
GGPGLNHIGLLANLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLY
HLFEEFANFEQVTIIDIILGFLSFFVVSLGGVFVGVIYGVIAAFTSRFTSHIRVIEPLFV
FLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLI
FIFLGVSTVAGHHYWNWTFVISTLLFCLIARVLGVLVLTWFINKFRIVKLTPKDQFIIAY
GGLRGAIAFSLCYLLDYKHFGMRDMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQET
KRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLI
AFYHKMEMKQAIELVESGGIGKIPSAVSTVSIQNINPKTLPVERILPALSKDKEEEIRKI
LRNNLQKTRQRLRSYNRHTLVADPYEEAWNQMLLRRQKARQLEQKMNNYLTVPAHKLDSP
TMSRARIGSDPLAYEPKADSENLPIITIDPASPQSPESVDLMNEEPKGCGGLPPSPEEDE
EGLVMRVKEPSSPGTDDVFTPGTGDSPSNQRMLRCLSDPGPRPEPEEGEPFIPKAQ
NT seq 2331 nt   +upstreamnt  +downstreamnt
atgctgacctccgagcccccgcaggggcagccggcccagccgccccgggcggagatcggg
gggttcacccccgcgccgcccgcctccgcccaggagatccagccgctgaacaagcagccg
gccaacggctcgggcgaggggcacgccaagccccgcaaagccttcccggtcctggccatc
gactacgaccacatccgcatccccttcgagatctccctctggatcctgctggcctgcctc
atgaagctgggcttccacgtgatcccttcggtgtccaacatcgttcctgagagctgcttg
ctcatcgtggtgggccttttggttggggggctcatcaaaggggtgggtgaaaagccccct
atcctcaagtcggacatcttcttcctcttcctcctcccacccatcatcttggacgctggc
tatttcctccctttgcgccagttcaccgagaacctgggcaccatcctcatcttcgccgtg
gtggggacagtctggaatgccttctttttgggtggcctgatgtacgccgtgtgccagctt
ggtggccctggcctgaaccacattggcctcctggccaacctgctctttggcagcatcatc
tcggccgtggacccggtggccgtgctggccgtctttgaggagatccacatcaacgagctg
ctccacatcttggtcttcggggagtcccttctgaacgatgccgtcacggttgtcctctat
cacctctttgaggagtttgccaacttcgagcaggtgaccattatcgatatcatcctcggc
ttcctcagcttctttgtggtgtcgctgggcggtgtcttcgtgggcgtcatttatggggtg
atcgctgccttcacgtcccgcttcacctcccacatccgagtcatcgagcccctcttcgtc
ttcctctacagctacatggcgtatctctccgctgagcttttccacctctccggcatcatg
gcgctcatcgcctctggcgtggtcatgcggccttatgtggaagccaacatctcccacaag
tcccacaccaccatcaagtatttccttaagatgtggagcagcgtgagcgagaccctcatc
ttcatcttcctgggcgtctccaccgtggctggccaccactactggaactggacctttgtt
atcagcacgctgctcttctgcctcatcgcaagagttttaggcgtcctggtcctcacctgg
ttcatcaacaagttccgaattgtgaagctgacgccgaaggaccagttcatcatcgcctat
gggggcctgcggggagccatcgccttctccctctgttacctcctggactataagcatttt
ggcatgagggacatgttcctcacagccatcatcacggtcatcttcttcacagtctttgtg
cagggcatgaccatccggcccttggtggacctgctggcggtgaagaagaagcaagagacg
aaacgctccatcaacgaagagatccacacgcagttcttggatcaccttctgacggggatt
gaggatatctgtggtcactacgggcatcaccactggaaggacaagctgaatcgcttcaac
aagaagtatgtgaagaagtgcctgattgcgggggagcggtccaaggagccccagctcatc
gctttctatcacaagatggagatgaagcaggcaatcgagctggtggagagtgggggcata
ggcaagatcccctctgctgtctccaccgtctccatccagaacatcaaccccaagaccctc
cctgtggagcgcatccttccggccctgtccaaggacaaggaggaggagatccggaaaatc
cttcgcaacaacctgcagaaaaccaggcagaggttgcgatcctacaaccggcacacgctt
gtggctgacccctacgaggaagcctggaaccagatgctcctgcggaggcagaaggcccgg
cagctggaacagaagatgaacaactacttgacagtgccggctcacaagctcgattcgccc
accatgtcccgggctcgcataggctcagacccgctggcctatgaacccaaggcggactcg
gagaacctgcccatcatcaccatcgacccggcctccccgcagtccccagagtctgtggac
ctgatgaacgaggagcccaagggctgtggcggcctcccgccctcgcccgaggaggacgag
gaggggctggtgatgcgggtgaaggagccttcctccccgggtaccgatgatgtcttcacc
ccagggactggcgacagccccagcaaccagcggatgctgcgatgcctgagcgatccgggg
cctcggccagagccagaggagggggaacccttcatccccaaggcccagtag

DBGET integrated database retrieval system