KEGG   Nostoc sp. NIES-3756: NOS3756_04110
Entry
NOS3756_04110     CDS       T04170                                 

Gene name
sodB
Definition
(GenBank) iron superoxide dismutase SodB
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
non  Nostoc sp. NIES-3756
Brite
Enzymes [BR:non01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NOS3756_04110 (sodB)
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Other DBs
NCBI-ProteinID: BAT51488
LinkDB
Position
complement(494434..495036)
AA seq 200 aa
MAFVQEPLPYDFNALEPYGMKGETFEYHYGKHHKAYVDNLNKLVDGTELADKSLEEVIKT
SFKDSSKAGIFNNSAQVWNHTFFWNSLKPSGGGAPTGELAAKINQDFGSFDKFKEEFSNA
AATQFGSGWAWLIDDGGTLKVIKTPNAENPLAYGQKALLTLDVWEHAYYIDFKNARPAFI
KNYLEQLVNWDFAAANYAKA
NT seq 603 nt   +upstreamnt  +downstreamnt
atggcatttgtacaggaaccactaccctacgattttaatgctctagagccgtatggcatg
aaaggtgagactttcgagtatcactatggcaaacatcacaaagcctatgtagataactta
aacaagctagtcgatggtacagaactggctgataaatccttagaagaagtcatcaaaacc
tccttcaaagattcttccaaagcgggaatctttaacaactctgctcaagtatggaaccat
acattcttctggaactctttaaaaccctcaggtggtggcgcacctacaggtgaactcgca
gctaagattaatcaagactttggtagcttcgacaagttcaaagaagaattttctaacgcg
gctgctactcaattcggtagtgggtgggcttggctgattgatgatggtggtacactcaaa
gtcatcaaaacaccaaacgccgaaaatcccttagcttatggacaaaaagcactcttgact
ttggatgtgtgggaacacgcctattacatcgacttcaaaaacgctcgtccagcatttatc
aagaattacttagagcaattagttaactgggactttgctgctgcaaattacgctaaggct
taa

DBGET integrated database retrieval system