KEGG   Nostoc sp. PCC 7524: Nos7524_1027
Entry
Nos7524_1027      CDS       T02363                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
nop  Nostoc sp. PCC 7524
Brite
Enzymes [BR:nop01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Nos7524_1027
SSDB
Motif
Pfam: Sod_Fe_C Sod_Fe_N Peptidase_C107
Other DBs
NCBI-ProteinID: AFY46921
UniProt: K9QP38
LinkDB
Position
complement(1190440..1191036)
AA seq 198 aa
MAFTQPPLPYDFNALEAYGMKGETFEYHYGKHHKAYVDNLNKLTDGTELADKSLEEVIQI
SFKDSSKTGIFNNAAQVWNHTFFWNCLKPAGGGAPTGELAARIDKDFGGFDKFQEEFSNA
AATQFGSGWAWLVDDGGTLKVMKTPNAENPLAHGKKALLTIDVWEHAYYIDFRNARPAFI
KNFLDQLVNWEFAAANLG
NT seq 597 nt   +upstreamnt  +downstreamnt
atggcattcacacaaccacccttaccttacgacttcaatgctctagaggcgtatggcatg
aaaggtgaaacattcgagtatcactatggcaagcatcacaaagcttatgtagataacctc
aacaagctcaccgacggtacagaactagctgataaatccttagaagaagtcatccaaatc
tcctttaaagattcatctaagacaggaatcttcaacaacgccgcccaagtttggaaccac
accttcttctggaattgtttgaaacccgcaggcggcggcgcacctacaggagaattagct
gctaggattgataaagattttggtggcttcgacaaatttcaagaagaattttctaacgct
gctgcaacccagtttggtagcggttgggcttggttggttgatgatggtggcacactcaaa
gtgatgaaaacaccaaatgcagaaaaccccctagctcatggtaaaaaagcactcctaact
atagatgtttgggaacacgcctactacatcgactttagaaatgctcgtccagcatttatc
aaaaacttcttagatcaattagtcaactgggaatttgctgctgcaaacttaggttaa

DBGET integrated database retrieval system