KEGG   Nostoc sp. PCC 7107: Nos7107_0265
Entry
Nos7107_0265      CDS       T02362                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00010  Glycolysis / Gluconeogenesis
nos00020  Citrate cycle (TCA cycle)
nos00620  Pyruvate metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01200  Carbon metabolism
Module
nos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7107_0265
   00020 Citrate cycle (TCA cycle)
    Nos7107_0265
   00620 Pyruvate metabolism
    Nos7107_0265
Enzymes [BR:nos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nos7107_0265
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL GCV_H
Other DBs
NCBI-ProteinID: AFY40950
UniProt: K9Q5H4
LinkDB
Position
304733..306037
AA seq 434 aa
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVQAGESAAVGSAIAYVAETEAEIEAAKSLANSGSTAATASAPKKVPATAAVGASTAAAH
NGNGSNHKEGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVAEDVEAIVNKSKPAVPTT
PVSTVAPVVPAATPAVAAASAPIPSVSSVVPGQIVPLTTLQNAVVRGMVASLAVPVFRVG
YTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVA
VAMDDGGLITPVLRNADMVDIYSLSRNWKSLVDRARAKQLQPDEYNTGTFTLSNLGMFGV
DTFDAILPPGQGSILAIGAARPQLVATSDGLFGVTQQMQVNITCDHRIIYGAHAAAFLQD
LSKLIETNAQSLTL
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgagcattcacgaagtattcatgccggcgctgagttccaccatgaccgaaggtaaaatc
gtttcctgggtaaaatcgccaggggataaagtggaaaaaggcgagacagtggtggttgtc
gagtcagataaggcagacatggatgtagaaaccttctatgaaggatatctggcacacatc
attgtacaagccggtgagagcgcggctgttggtagtgcgattgcctacgtagctgaaacc
gaagcagaaattgaagcagcaaaatctctggctaattccggtagcactgcggcgacagca
tctgctcccaaaaaagtcccagcgacagcagctgtcggcgcatccaccgccgccgctcac
aacggtaacggctcgaaccacaaagaaggtagactcgtcgcttccccccgcgcccgcaag
ttagcaaaagaattaaaagttgatttaactagcctcaaaggtagtggcccctacggtcga
attgtggctgaagatgtggaagctatcgttaataaaagtaaacccgcggttcctaccacc
cccgtatcgactgttgcgccagtagttccagcagcaacacccgcggtagcagcagcctca
gcaccaattccctctgtcagtagtgtagttcctggtcaaatcgtacctttgactactctg
caaaatgctgtagtccgagggatggttgctagtttagctgtacctgttttccgtgtaggc
tacacaattactaccgatggcttagataagctttacaaacaaattaaatcgaaaggcgtg
acaatgactgctctactggcgaaagctgttgcagtcacattacaaaaacatccattactc
aacgccagctactcagatcaaggaattgtctatcattctgatatcaacatatctgtagct
gtggcaatggatgacggaggattaattacaccagtattgcggaatgcagacatggtagat
atttattccctctcacgcaattggaaatctttagtagaccgcgctcgcgccaagcaacta
caacctgacgaatacaacactggtacttttaccctgtctaacttagggatgtttggggtc
gatacttttgatgcaattttaccacctggtcaaggttcaattctggcgatcggtgcggct
cgtccccaactagtggctacttctgatggtttatttggggtaacccaacaaatgcaggta
aatatcacctgtgaccaccgaattatttatggcgctcacgccgcagccttcctacaagac
ttgagcaagttgattgaaactaacgctcaatctttaaccctctaa

DBGET integrated database retrieval system