KEGG   Nostoc sp. PCC 7107: Nos7107_0265Help
Entry
Nos7107_0265      CDS       T02362                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
nos  Nostoc sp. PCC 7107
Pathway
nos00010  Glycolysis / Gluconeogenesis
nos00020  Citrate cycle (TCA cycle)
nos00620  Pyruvate metabolism
nos01100  Metabolic pathways
nos01110  Biosynthesis of secondary metabolites
nos01120  Microbial metabolism in diverse environments
nos01130  Biosynthesis of antibiotics
nos01200  Carbon metabolism
Module
nos_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:nos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Nos7107_0265
   00020 Citrate cycle (TCA cycle)
    Nos7107_0265
   00620 Pyruvate metabolism
    Nos7107_0265
Enzymes [BR:nos01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Nos7107_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase MadL GCV_H
Motif
Other DBs
NCBI-ProteinID: AFY40950
UniProt: K9Q5H4
LinkDB All DBs
Position
304733..306037
Genome map
AA seq 434 aa AA seqDB search
MSIHEVFMPALSSTMTEGKIVSWVKSPGDKVEKGETVVVVESDKADMDVETFYEGYLAHI
IVQAGESAAVGSAIAYVAETEAEIEAAKSLANSGSTAATASAPKKVPATAAVGASTAAAH
NGNGSNHKEGRLVASPRARKLAKELKVDLTSLKGSGPYGRIVAEDVEAIVNKSKPAVPTT
PVSTVAPVVPAATPAVAAASAPIPSVSSVVPGQIVPLTTLQNAVVRGMVASLAVPVFRVG
YTITTDGLDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLLNASYSDQGIVYHSDINISVA
VAMDDGGLITPVLRNADMVDIYSLSRNWKSLVDRARAKQLQPDEYNTGTFTLSNLGMFGV
DTFDAILPPGQGSILAIGAARPQLVATSDGLFGVTQQMQVNITCDHRIIYGAHAAAFLQD
LSKLIETNAQSLTL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcattcacgaagtattcatgccggcgctgagttccaccatgaccgaaggtaaaatc
gtttcctgggtaaaatcgccaggggataaagtggaaaaaggcgagacagtggtggttgtc
gagtcagataaggcagacatggatgtagaaaccttctatgaaggatatctggcacacatc
attgtacaagccggtgagagcgcggctgttggtagtgcgattgcctacgtagctgaaacc
gaagcagaaattgaagcagcaaaatctctggctaattccggtagcactgcggcgacagca
tctgctcccaaaaaagtcccagcgacagcagctgtcggcgcatccaccgccgccgctcac
aacggtaacggctcgaaccacaaagaaggtagactcgtcgcttccccccgcgcccgcaag
ttagcaaaagaattaaaagttgatttaactagcctcaaaggtagtggcccctacggtcga
attgtggctgaagatgtggaagctatcgttaataaaagtaaacccgcggttcctaccacc
cccgtatcgactgttgcgccagtagttccagcagcaacacccgcggtagcagcagcctca
gcaccaattccctctgtcagtagtgtagttcctggtcaaatcgtacctttgactactctg
caaaatgctgtagtccgagggatggttgctagtttagctgtacctgttttccgtgtaggc
tacacaattactaccgatggcttagataagctttacaaacaaattaaatcgaaaggcgtg
acaatgactgctctactggcgaaagctgttgcagtcacattacaaaaacatccattactc
aacgccagctactcagatcaaggaattgtctatcattctgatatcaacatatctgtagct
gtggcaatggatgacggaggattaattacaccagtattgcggaatgcagacatggtagat
atttattccctctcacgcaattggaaatctttagtagaccgcgctcgcgccaagcaacta
caacctgacgaatacaacactggtacttttaccctgtctaacttagggatgtttggggtc
gatacttttgatgcaattttaccacctggtcaaggttcaattctggcgatcggtgcggct
cgtccccaactagtggctacttctgatggtttatttggggtaacccaacaaatgcaggta
aatatcacctgtgaccaccgaattatttatggcgctcacgccgcagccttcctacaagac
ttgagcaagttgattgaaactaacgctcaatctttaaccctctaa

DBGET integrated database retrieval system