KEGG   Novosphingobium sp. P6W: TQ38_017685Help
Entry
TQ38_017685       CDS       T05550                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
nov  Novosphingobium sp. P6W
Pathway
nov03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:nov00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    TQ38_017685 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nov03400]
    TQ38_017685 (ligD)
Enzymes [BR:nov01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     TQ38_017685 (ligD)
DNA repair and recombination proteins [BR:nov03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     TQ38_017685 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AXB78481
UniProt: A0A2Z5EFP6
LinkDB All DBs
Position
2:complement(276049..278586)
Genome map
AA seq 845 aa AA seqDB search
MAAVPASGRSGKAGNPGADLLAEYNRKRDFARTAEPAGRSGRTGGNSFIVQKHAARRLHW
DFRLEVDGVLKSWAVTRGPSADPEDKRLAVRTEDHPLSYSEFEGGIPKGEYGGGTVMLWD
RGTWAPIAGKSAKDIEDGHLHFTLDGERMKGEWLLVRMKPRPGEKRENWLLRKVKDAHAQ
TGDVLVEQGLSSVLTGRTMAEIEADKGGTHSLKGKKGDAFAKVMEKASARNAQSARKTPG
NPPKFRAVQLATLVDTVPTGNLWMHEIKFDGYRALVAAAGAKVVVHTRSGLDWTNKFAPL
AAHIAALDLPPCLIDGEIIARGVDGNPDFSSLQAVLKRGNGSQSEHQPLEFHAFDLLELD
GEDLAAMPNIERKERLEALLADAAPPVFVADHVIGAGEKLYDAMCAAGQEGIIAKRVDAP
YRGRRTKEWVKVKCTRRQEFVIVGWAKSSAKGRPFSSLLLGQYEGKTLVYRGKVGTGFDA
EGLADMAVRLEKLARKTAPLEIERAETRGASWVTPKLVAEVAFAELTGEGRVRHGSFLGL
RTDKKARAVTPEKAQAAPQAAIAVKISNRERVIFPESGGTKGDLADYYAAVAPLILPFVA
NRPISLVRCPQGRAKKCFFQKHDSGTFGDHVHHVPIREKDGGAEDYLYLDDAEGLLSCVQ
MGTIEFHGWAARADDVEHPDRMIFDLDPDEGLDFKECVRAAGDIRARLADLGLVTFAMLS
GGKGIHVVVPLKRGHDWDTHKDFSRRFAEAMSLSEPDRYVATMSKAKRKGRIFIDWLRNQ
RGATAVLPYSARSREGAPVAVPISWDELDATKTAHPFSIGDAPELIRRSDTLHGWGFADQ
RLPEI
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
gtggcagccgtgcccgcaagcgggcgtagcggcaaggccggcaaccccggcgccgacctt
ctcgccgaatacaaccgcaagcgcgacttcgcgaggaccgccgaacccgcaggcaggagc
ggccggaccggcggcaacagcttcatcgtgcagaagcacgccgcgcggcgattgcactgg
gatttccgcctcgaagtcgatggtgtgctcaagtcctgggcagtgacccgggggccaagt
gccgatcccgaagacaagcgccttgccgtccgcaccgaggaccatccactctcttacagc
gaattcgagggcggcatccccaagggcgagtacggcggcggcacggtgatgctctgggac
cggggcacctgggcgccgatcgcgggcaagagcgcgaaggacatcgaggacggccatctc
catttcaccctcgacggcgagcggatgaaaggcgaatggctgctggtgcgcatgaagccc
aggccgggcgagaagcgcgagaactggttgctgcgcaaggtgaaggatgcccatgcgcag
acgggcgatgtccttgtcgagcagggcctcagcagcgtcctcaccggccgcaccatggcc
gagattgaagccgacaagggcggcacccattcgctgaaaggcaagaagggcgatgctttc
gcgaaggtcatggaaaaggcctcggcccgcaatgcgcagtccgcgcggaaaacgccgggc
aacccgccgaaattccgcgccgtccagctcgccacgctggtcgacactgtacccaccggc
aatctttggatgcacgagataaagttcgacggctaccgtgcgctcgtcgccgcggcgggc
gccaaggtcgtcgtccatacccgcagcggcctcgactggaccaacaagttcgccccgctc
gccgcgcacatcgccgcgttggacctgcctccctgcctgatcgatggcgagatcatcgcc
cggggggtggacggcaatcccgatttctccagcctccaggccgtgctcaagcgcggcaac
ggcagccagagcgaacaccagcccctggaatttcatgcgttcgacctgctcgaactcgat
ggggaggatctggcggcgatgcccaacatcgaacgcaaggaacggctcgaagcgctgctg
gcggatgccgctccgcccgttttcgtcgccgaccacgtgatcggcgcgggcgaaaagctc
tacgacgcgatgtgtgctgccgggcaggaagggatcatcgccaagcgcgtcgatgcgccg
taccggggccgccgcaccaaggaatgggtcaaggtcaagtgtacccggcgacaagagttc
gtcatcgtgggatgggcgaagtcgagcgccaagggtcgtccgttctcgtccctgttgctc
ggtcagtacgaaggcaagacccttgtctatcgcggcaaggtgggcaccggtttcgacgcc
gaggggcttgccgacatggcggtccggcttgagaagctggcgcgcaagactgcgccgctg
gagatcgagcgggccgagacacgcggcgcaagctgggtcactccgaaactggtggcagaa
gtggcctttgccgaactgaccggcgagggccgtgttcgccatggcagcttcctcggcctc
aggaccgacaagaaggctcgggcggtgaccccggagaaagcccaggccgcgccgcaggcc
gctatcgcagtgaagatcagtaaccgtgagcgcgtcatcttccccgaaagcggcggcact
aagggcgaccttgcggactactatgccgccgtcgcgccgctcatactgccgttcgtcgcg
aaccggccgatcagcctcgtccgctgcccgcagggacgagcgaagaaatgcttttttcag
aagcacgacagcggcactttcggcgatcacgttcatcacgtgccgatccgcgaaaaggac
ggcggcgcggaggattacctctatctggacgatgccgagggacttctttcctgcgtgcag
atgggcacgatcgaattccacggctgggcggcacgggccgacgacgtggaacatcccgat
cgcatgatctttgacctcgaccccgacgaagggctggatttcaaggaatgcgtccgagcc
gcaggcgacatccgcgcccggctggccgaccttgggctggtgaccttcgccatgctctcc
ggcggcaagggcatccatgtcgtcgtgccgctgaaacggggccacgactgggatacccac
aaggacttctcgcgccgctttgccgaagccatgagcctgtcagagcccgaccgctacgtt
gcaaccatgagcaaggccaagcgcaagggccgcatcttcatcgactggttgcgcaatcag
cgcggggcgacggccgtactgccgtattccgcacggtcacgggaaggcgccccggtcgcc
gtcccgataagctgggacgaactcgatgccacgaagactgcgcatccattctcgatcggc
gatgctcctgagttgatcaggcggtcggatacgctgcatggctggggttttgccgaccaa
cggcttccggaaatttga

DBGET integrated database retrieval system