KEGG   Nocardia sp. CS682: DMB37_10835Help
Entry
DMB37_10835       CDS       T06040                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K22893  serine/threonine kinase PknH [EC:2.7.11.1]
Organism
noz  Nocardia sp. CS682
Brite
KEGG Orthology (KO) [BR:noz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:noz01001]
    DMB37_10835
Enzymes [BR:noz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     DMB37_10835
Protein kinases [BR:noz01001]
 Serine/threonine kinases: Other
  Bacterial family
   DMB37_10835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: QBS40543
UniProt: A0A4P7H1I8
LinkDB All DBs
Position
complement(2413053..2414525)
Genome map
AA seq 490 aa AA seqDB search
MGEVYEAYDTVKDRVVAVKLLPTELAQDPMFQQRFRRESQAAARVAEPHVIPIHDWGEID
GVLYIDMRLVRGHDLRSVLRGEGPLTPARAIGIVEQIAAALDAAHAEGLVHRDVKPANIL
VTASDFAYLADFGIARSANDPNMTGTGEAAVGSYSYISPERFENGPVTGTADVYSLACVL
YECLTGTTPFRAEAMSVLIHSHLSMPPPRPSAVRAGVPAALDEVIARGMAKRPTDRYSTA
GGLASAAKSALTGRPVVAVTELPTDQMGAVLPKAPPTVVFPNVGPEQLNANAVPTDAIAR
PPVNGRLGAGRIMPPEPNRGPGPRGEVVLREPHRVLEPSPDVDTGPKAAVTPAREATPRK
RRSRRRWLPVVGALIIVLALTGVVGWLGRGSFSSGPASLTLAPVPATARGCETKYPPAGR
FLYSAIGSEVTSCEFAEELRKAYGEGSDAAGTRQVTAFSPPLRQNFTMECVTLDGLVTCT
GGQNAIVYIY
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgggcgaggtctatgaggcctacgacacggtgaaggaccgggtcgtcgcggtcaagctg
ttgccgaccgagctcgcgcaagatccgatgttccagcagcggttccgccgggaatcgcag
gcggccgcgcgggtggccgagccgcacgtcatcccgatccacgactggggcgagatcgac
ggcgtgctctacatcgacatgcggctggtgcgcggccacgatctgcgctcggtgctgcgc
ggtgagggaccgctgacaccggcgcgcgcgatcggcatcgtcgagcagatcgccgccgcg
ctggacgccgcgcacgcggaggggttggtgcaccgggacgtcaagcccgccaacatcctc
gtcaccgcctcggacttcgcgtacctcgccgatttcggcatcgccaggtccgccaacgat
cccaacatgaccggcaccggcgaggccgcggtcggttcctacagctacatctcgccggaa
cgcttcgagaacggtccggtcaccggcaccgccgacgtctactcgctggcctgtgtgctc
tacgaatgcctcaccggcacaacaccgttccgggccgaggcgatgagtgtgctgatccac
tcgcatctttcgatgccgccgccgcgcccgagtgcggtccgggcgggggtgcccgccgcc
ttggacgaggtgatcgcgcggggcatggccaagcggccgacggaccgttactcgaccgcg
ggcgggctggcgtcggcggcgaagtcggcgctcaccggtcggccggtcgtcgcggtcacc
gagttgccgaccgaccagatgggcgcagtgctgccgaaagcgccgccgacggtggtgttt
ccgaatgtcggtcccgaacagctcaatgcgaacgccgtgccgaccgacgcgatcgcgcgg
ccgccggtcaacggccggctcggtgccggacggatcatgccgccggaaccgaatcgcggg
ccgggcccgcgaggcgaagtcgttctgcgcgaaccacatcgcgtcctggagccgagcccc
gatgttgataccggcccgaaagccgcggtgaccccggcaagggaggccacgccgcgcaaa
cgtcgatcacggcgtagatggctgccggtggtcggcgcgctcatcatcgtgctcgcgctg
accggtgtcgtcggctggctggggcggggttccttcagctccggccccgcgtcgctgacg
ctcgccccggtcccggccaccgcaaggggttgcgagacgaagtacccgccggccggccgt
ttcctctactcggcgatcggctccgaggtcacctcgtgcgagttcgccgaggaactgcgc
aaggcctacggcgagggatccgacgccgcgggcacccgccaggtgaccgcgttcagcccg
cccctgcggcagaacttcaccatggaatgcgtcaccctggacggcctggtcacctgcacc
ggcgggcagaacgcgatcgtctacatctactga

DBGET integrated database retrieval system