KEGG   Novosphingobium sp. PP1Y: PP1Y_AT25757
Entry
PP1Y_AT25757      CDS       T01515                                 

Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00010  Glycolysis / Gluconeogenesis
npp00020  Citrate cycle (TCA cycle)
npp00260  Glycine, serine and threonine metabolism
npp00280  Valine, leucine and isoleucine degradation
npp00310  Lysine degradation
npp00380  Tryptophan metabolism
npp00620  Pyruvate metabolism
npp00630  Glyoxylate and dicarboxylate metabolism
npp00640  Propanoate metabolism
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01200  Carbon metabolism
Module
npp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
npp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
npp_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PP1Y_AT25757
   00020 Citrate cycle (TCA cycle)
    PP1Y_AT25757
   00620 Pyruvate metabolism
    PP1Y_AT25757
   00630 Glyoxylate and dicarboxylate metabolism
    PP1Y_AT25757
   00640 Propanoate metabolism
    PP1Y_AT25757
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PP1Y_AT25757
   00280 Valine, leucine and isoleucine degradation
    PP1Y_AT25757
   00310 Lysine degradation
    PP1Y_AT25757
   00380 Tryptophan metabolism
    PP1Y_AT25757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:npp04147]
    PP1Y_AT25757
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     PP1Y_AT25757
Exosome [BR:npp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PP1Y_AT25757
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 FAD_binding_2 GIDA FAD_binding_3 FAD_oxidored HI0933_like K_oxygenase Thi4 2-Hacid_dh_C AlaDh_PNT_C Lycopene_cycl 3HCDH_N GMC_oxred_N
Other DBs
NCBI-ProteinID: CCA93366
UniProt: F6IPL4
LinkDB
Position
2704719..2706155
AA seq 478 aa
MSRRFEAVADSYDVIVLGSGPGGYVSAIRCAQLGLKTAIVERELLGGICLNWGCIPTKAL
LRSAEVFHQMKHAKAYGLAAENITADLDAVVKRSRGVASQLNKGVTHLMKKNKIAVHTGT
GKVVAKGKLAVTDADGKTTELQARHIIVATGARARELPFAKADGKRIWTYRHAMTPSEMP
TKLLVMGSGAIGIEFASFFNDMGADVTVVEMLDRIVPVEDADVSTFLEKALTKQGMTIMT
GAGVEAITASDKGVKAKIKGKDGKVTEHEFSHVISAVGIVPNTEEIGLEGVGVKLDRGFI
QIDDYGRTGVAGIWAIGDCTPGPWLAHKASHEGVTAAEAIAKELGNKDVHPHPLDRNNIP
GCTYCHPQIASVGMTEAKAKEAGYEVKVGNFPFIGNGKAIALGEPEGFIKTVFDAKTGEL
LGAHMIGAEVTELIQGYVVGKTLETTEAELMNTVFPHPTLSEMMHEATLAAYGRALHI
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagcaggagatttgaagcagtggcagattcttacgacgtcatcgttctcggttccggc
cccggtggctacgtctcggcgatccgctgcgcgcagctgggtctgaagacggccatcgtc
gagcgcgagctgctgggcggcatctgccttaactggggctgcattccgaccaaggcactg
ctgcgctcggccgaagtgttccaccagatgaagcacgccaaggcctatggcctggcggca
gaaaacatcaccgccgatctcgatgcggtggtgaagcgttcgcgcggagttgcctcgcag
ctcaacaagggcgtgacgcacctgatgaagaagaacaagatcgccgtccacaccggcacc
ggcaaagtcgttgccaagggcaagctggcggtgaccgatgctgacggcaagacgaccgag
ctgcaggcaaggcacatcatcgttgccaccggcgcgcgggcacgcgagctgcctttcgcc
aaggccgacggcaagcgcatctggacctaccgccatgcgatgacgccttcggaaatgccg
accaagctgctggtcatgggctctggcgcgatcggtatcgagttcgccagcttcttcaat
gatatgggcgccgacgtgaccgtagtcgaaatgctcgacaggatcgtgccggtcgaagac
gctgacgtttccaccttcctcgaaaaggcgctgaccaagcagggcatgacgatcatgacc
ggcgccggcgtcgaggcgatcaccgccagcgacaagggcgtgaaggccaagatcaagggt
aaggacggcaaggtcaccgagcacgaattcagccatgtcatctcggccgtcggcatcgtg
ccgaacaccgaagagatcggccttgaaggcgtgggcgtgaagctcgatcgcggtttcatc
cagatcgacgattacggccgcaccggcgtggccggcatctgggccatcggtgactgcacg
cccggaccgtggctggcccacaaggcgagccatgaaggcgttaccgctgccgaggcgatt
gccaaggaactgggcaacaaggacgtccatccccatccgctcgaccgcaacaacatcccg
ggctgcacttactgccaccctcagatcgcgtccgtcggcatgaccgaggccaaggccaag
gaagcgggctacgaagtgaaggtcggcaacttccccttcatcggcaacggcaaggcgatt
gcgctgggtgagccggaaggcttcatcaagaccgtattcgatgccaagaccggtgaactg
ctcggcgcacacatgatcggtgcggaagtgaccgagttgatccagggctatgttgtcggc
aagaccctcgagaccaccgaggccgagctgatgaacaccgtgttcccgcacccgacgctg
tcggaaatgatgcacgaggcaacactggccgcttacgggcgcgcgctccacatctga

DBGET integrated database retrieval system