KEGG   Novosphingobium sp. PP1Y: PP1Y_AT29766
Entry
PP1Y_AT29766      CDS       T01515                                 

Definition
(GenBank) glutathione reductase (NADPH)
  KO
K00383  glutathione reductase (NADPH) [EC:1.8.1.7]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00480  Glutathione metabolism
npp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PP1Y_AT29766
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.7  glutathione-disulfide reductase
     PP1Y_AT29766
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 HI0933_like AlaDh_PNT_C 2-Hacid_dh_C FAD_oxidored 3HCDH_N NAD_binding_7 K_oxygenase
Other DBs
NCBI-ProteinID: CCA93741
UniProt: F6IGP7
LinkDB
Position
complement(3127186..3128532)
AA seq 448 aa
MSEYDYDLFTIGAGSGGVRASRVAAAHGARVAVAEEFRVGGTCVIRGCVPKKMLVYGAHF
AEDLEDAKHFGWDIPEAKFDWVKLRDNVLNDVDRLNGLYTQTLTNHEVEIFHERARITGP
HEITLSNGEKKTARVILIATGARPHVPSFPGHELGITSNEAFHLDAIPGRVLIAGAGYIA
NEFAGIFNEFGAKVTLMNRSDQLLRGYDESVRDRLLQISLTKGIEFRFNAEFERIEQNED
GSLKVSMSNHDPMDVDCVLFATGRVPNVEGLGLADVGVEVDDKGAIKVDEYSQTSVDHIY
AVGDVTNRVQLTPVAIREGQAFADTVFGDKPTTVDYSCIPSAVFSHPPIAGVGMTEGEAN
QKLGTVRVYTSDFRPMKNVVAHRNERSLYKMICDAETDRVVGLHMIGPEAPEIMQAAAIA
VKAGLTKADFDATVAVHPTMSEELVLLK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtccgagtacgattatgaccttttcaccatcggcgccggttcgggcggcgtgcgcgcc
agccgcgttgcggcagcgcacggcgcgcgggtagccgtggcggaagagttcagggttggc
gggacatgcgtgattcgcggctgcgtccctaagaagatgctggtttacggcgcccatttc
gccgaagatctggaagacgccaagcacttcggctgggacattcccgaggccaagttcgac
tgggtcaagctgcgtgacaacgtgctcaacgatgtcgaccgcctcaatggtctctacacg
cagacgctcaccaatcacgaggtggagatctttcacgagcgggcacggatcacagggccg
cacgaaattaccttgtcgaacggcgagaagaagaccgccagggtcattctcatcgcgacg
ggcgcgcggccgcatgtgccctcattcccgggacatgagctgggcatcacctcgaacgag
gccttccatctcgatgcgattccgggtcgcgtcctgatcgccggtgcgggctacatcgcc
aatgagttcgcgggaatcttcaatgagttcggcgccaaggtgacgctgatgaaccgctcc
gaccagcttctgcgcggatacgatgaaagtgtgcgcgaccggctgctgcagatctcgctg
accaagggcatcgagttccgattcaatgccgaattcgagaggatcgagcagaatgaggac
ggctcgctcaaggtctcgatgagcaatcacgacccgatggacgtcgactgcgtgctgttc
gctaccggtcgcgtacccaatgtcgagggactaggcctcgcagacgtcggcgtggaagtc
gacgacaagggcgcaatcaaggtcgacgagtactcgcagaccagcgtcgatcatatctac
gccgtgggcgacgttacgaaccgcgtgcaactgaccccggtcgccatccgcgaaggacag
gcctttgccgatacggtcttcggcgacaagccgacgacggtcgattacagctgcattcct
tcggccgttttcagccatccgccgatcgcgggcgtgggcatgaccgagggagaggcgaac
cagaagctgggcactgtgcgggtctataccagcgacttccggccgatgaagaacgtcgtc
gcccaccgcaacgaacgctcgctctacaagatgatctgcgacgccgagacggaccgcgtc
gtggggctgcacatgatcgggcccgaggcccccgaaatcatgcaggcggctgcgatcgcg
gtaaaggcggggctgaccaaggcggacttcgacgccacggtcgcggtgcacccgacgatg
tcggaggaactcgtcctgctcaagtag

DBGET integrated database retrieval system