KEGG   Novosphingobium sp. PP1Y: PP1Y_AT30092
Entry
PP1Y_AT30092      CDS       T01515                                 

Definition
(GenBank) electron-transferring-flavoprotein dehydrogenase
  KO
K00311  electron-transferring-flavoprotein dehydrogenase [EC:1.5.5.1]
Organism
npp  Novosphingobium sp. PP1Y
Brite
KEGG Orthology (KO) [BR:npp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP1Y_AT30092
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.1  electron-transferring-flavoprotein dehydrogenase
     PP1Y_AT30092
SSDB
Motif
Pfam: ETF_QO DAO FAD_binding_2 NAD_binding_8 Thi4 Lycopene_cycl HI0933_like Pyr_redox_2 Pyr_redox_3 FAD_binding_3 K_oxygenase FAD_oxidored Trp_halogenase NAD_binding_9 GMC_oxred_N Fer4_7 Mqo GIDA
Other DBs
NCBI-ProteinID: CCA93770
UniProt: F6IGS6
LinkDB
Position
complement(3162895..3164544)
AA seq 549 aa
MIEREEMPYDVVVVGGGPAGLSTAIRLKQVDPELQVCVLEKGSEIGAHILSGATIDPKAL
DELLPGWADDGCPLAETPVTDNLHWHLTKKGKVSMPEIVMPPFMSNEGNFTGSLGNLCRW
LAEKAEELEVEIFPGFPAAEILYDDNGAVIGVQTGDMGVDREGNPKGDFQPGMNLLGKYT
VFCEGARGHLTKRLKAKFDLEANCEPQIYGLGIKELWDIDPDKHAPGRVIHTQGWPLSES
DSWGGGFLYHQANNQVSLGFVTALDYKNPYVYPFEEFQRWKQHPEIRKILEGGKRVAYGA
RAINEGGWQSVPQLAFPGGVLAGCSAGFVNVPRIKGTHTAMKSGMLAAEAIAAAIKAGRE
QDSLMEYDSAVRESWIAKELKLVQNAEPLVAKWGGELGTILAGADMWLRTLFGFGLAKPM
KHHTDASTLQRADLYKPIEYPKPDGVISFDRLTSVAYSFTNHEEEQPCHLRLKDPTVPTA
INLPVYAGPEARYCPAGVYEFVDPDGAGPRLQINAQNCVHCKTCDIKDPTQNIEWVTPEG
GGGPNYPNM
NT seq 1650 nt   +upstreamnt  +downstreamnt
atgattgaacgcgaagagatgccatacgacgtcgttgttgtcggcggcggtccggccggc
ctgtcgacggcgatccggctcaagcaggttgatcccgagctgcaggtctgcgttctggaa
aaaggctccgagatcggcgcccatatcctgtccggcgcgacgatcgaccccaaggcgctc
gacgagctgcttccggggtgggccgacgacggctgtccgctggccgaaacaccggtgacc
gacaacctgcactggcacctgacgaagaagggcaaggtctcgatgcccgagatcgtgatg
ccgcccttcatgtcgaacgaaggcaacttcacgggctcgctcggcaacttgtgccgctgg
cttgccgaaaaggccgaggaactcgaagtcgagatcttccccggcttcccggctgccgag
atcctctatgacgacaacggcgcggtgatcggcgtccagaccggcgacatgggcgttgac
cgcgagggcaatcccaagggcgacttccagccgggcatgaacctgctcggcaagtacacc
gtcttctgcgaaggcgcgcgcggccacctgaccaagcgtctcaaggccaagttcgacctc
gaggcgaactgcgagccgcagatctatggtcttggcatcaaggaactctgggacatcgat
cccgacaaacatgcgccgggccgggtcatccacacccagggctggccgctcagcgagagc
gattcctggggcggcggcttcctgtaccaccaggccaacaaccaggtctcgctcggcttc
gtgactgcgctcgactacaagaatccctacgtctaccccttcgaggaattccagcgctgg
aagcagcacccggaaatccgcaagatcctcgagggcggcaagcgcgtggcctatggcgcg
cgcgcaatcaacgagggtggctggcagtcggtgccgcagcttgccttcccgggcggcgtt
ctggccggttgctcggcagggttcgtcaacgtgccgcgcatcaagggcacgcacaccgcg
atgaagtcgggcatgctcgctgccgaggcgattgccgccgcgatcaaggcgggccgtgag
caggactcgctcatggaatacgacagtgccgttcgcgaaagctggatcgccaaggagctc
aagctcgtgcagaacgccgagccgctggtcgccaagtggggcggcgaactgggcacgatc
cttgccggtgcggacatgtggctgcgcaccctgttcggcttcggtcttgccaagccgatg
aagcaccacaccgatgcctcgacgctgcagcgggccgatctgtacaagccgatcgaatat
cccaagcccgacggcgtcatcagcttcgaccgcctgaccagtgtcgcctactcgttcacc
aaccacgaggaagagcagccctgtcacctgcggctcaaggatccgacggtacccaccgcg
atcaacctgccggtctatgccgggccggaagcgcgctactgcccggcaggcgtctatgag
ttcgtcgacccggatggtgcggggccgcgtctgcagatcaacgcgcagaactgcgttcat
tgcaagacctgcgacatcaaggacccgacccagaacatcgaatgggtcacgcccgaaggc
ggcggcggaccgaactacccgaacatgtga

DBGET integrated database retrieval system