KEGG   Novosphingobium sp. PP1Y: PP1Y_AT33677Help
Entry
PP1Y_AT33677      CDS       T01515                                 

Definition
(GenBank) alkyl hydroperoxide reductase, subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
npp  Novosphingobium sp. PP1Y
Brite
KEGG Orthology (KO) [BR:npp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PP1Y_AT33677
Enzymes [BR:npp01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PP1Y_AT33677
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored FAD_binding_2 AlaDh_PNT_C K_oxygenase DAO Thi4 Spermine_synth FAD_binding_3 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: CCA94087
UniProt: F6IIL9
LinkDB All DBs
Position
3525071..3526669
Genome map
AA seq 532 aa AA seqDB search
MLDENLKQQLSQYLGMLREPIELVASLSDDAKSAETRDLLTQIAALSDKVTAHFDGDDAR
KPSFIIRRASNTEAWVRFAGVPLGHEFTSLVLALLWTGGHPPKVSDEVLDQIRQLEGDFD
FEMYFSLSCHNCPDVVQALTLMALYNPRITATLIEGGAFKDEVEGRGVLAVPAVFLNGDM
WGSGKMSIEEILGKLDKGADARAAAKLADKKPFEVLVIGGGPAGASAAIYTARKGFSTGI
AAERMGGQVMDTMGIENFISVPYTEGPKLAAALEQHVGEYDIDTMNLLRAEKLIPASEAG
GYHEVQFSNGASLKARSLVLTTGARWRNLGVPGEAEYRTKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLIEFDARLRADQVLQDKLRSMKNVDILVSAQTTEVTGD
GEKVNGLTYKDRDSGEEHHVELEGVFVQIGLVPNTEWLKDSGLEMTRFGEIAIDGKAATN
LPGVFAAGDATTVPYKQIIIAMGEGSKAALSAFDYLIRNEAPEEIAQAAQAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgcttgatgaaaacctgaagcaacagctttcgcagtatctcggaatgctgcgcgaaccg
atcgaactcgttgcctcgctgagcgacgacgcaaagtcggccgaaacccgcgacctgctg
acccagatcgccgcgctctccgacaaggtcaccgcccatttcgacggcgacgacgcgcgc
aagcccagcttcatcatccgtcgtgcctcgaacaccgaggcatgggtccgcttcgccggc
gttccgctcggccacgaattcacgtccctggtcctcgctctgctctggaccggcggccac
ccgcccaaggtatcggacgaggtccttgaccagatccgccagcttgagggcgacttcgat
ttcgagatgtatttctcgctctcgtgccacaactgtccggatgtcgttcaggcgctgacc
ctgatggcgctctacaacccgcgcatcaccgccaccctgatcgaaggcggcgcgttcaag
gacgaggtcgaaggccgcggcgtcctcgccgtgcccgccgtgttcctcaacggtgacatg
tggggctcgggcaagatgagcatcgaggaaatcctcggcaagctcgacaagggcgccgac
gccagggctgcggccaagcttgccgacaagaagcccttcgaggtgctcgtcatcggcggc
ggtcctgccggcgcctcggccgcgatctacaccgcgcgcaagggcttcagcaccggcatc
gccgccgagcgcatgggcggccaggtgatggacaccatgggcatcgagaacttcatctct
gttccctacaccgaaggtcccaaacttgccgccgcgctggaacagcacgtgggcgagtat
gacatcgacaccatgaacctgcttcgtgccgagaagctgatcccggccagcgaagccggc
ggctatcacgaagtgcagttctcgaacggcgcatcgctcaaggcccgttcgctggttctc
accaccggcgcgcgctggcgcaacctgggcgtgcccggcgaggccgagtaccgcaccaag
ggcgtggcctattgcccacactgcgacggccccctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaactcgggcgtcgaggcggcgatcgacctggccaatatcgtcggccac
gtcaccctgatcgagttcgacgccaggctgcgcgccgaccaggtcctgcaggacaagctg
cgttcgatgaagaacgtcgacatcctcgtctccgcccagaccaccgaggtcaccggcgac
ggcgagaaggtcaacggcctgacctacaaggatcgcgacagcggcgaggaacaccacgtc
gagctcgaaggcgtcttcgtgcagatcggactggtgcccaacaccgagtggctcaaggac
tcgggtctcgagatgacccgcttcggcgagatcgcgatcgacggcaaggcggcgaccaac
ctgcccggcgtctttgccgcaggcgatgccaccacggtgccctacaagcagatcatcatc
gccatgggcgaaggatcgaaggcggcgctctccgcattcgactacctgatccgcaacgag
gcacccgaagagatcgcgcaggccgcccaggccgcctga

DBGET integrated database retrieval system