KEGG   Novosphingobium sp. PP1Y: PP1Y_AT35701
Entry
PP1Y_AT35701      CDS       T01515                                 

Definition
(GenBank) acetylornithine/N-succinyldiaminopimelate aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00220  Arginine biosynthesis
npp00300  Lysine biosynthesis
npp01100  Metabolic pathways
npp01110  Biosynthesis of secondary metabolites
npp01120  Microbial metabolism in diverse environments
npp01210  2-Oxocarboxylic acid metabolism
npp01230  Biosynthesis of amino acids
Module
npp_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
npp_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    PP1Y_AT35701
   00220 Arginine biosynthesis
    PP1Y_AT35701
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:npp01007]
    PP1Y_AT35701
Enzymes [BR:npp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     PP1Y_AT35701
    2.6.1.17  succinyldiaminopimelate transaminase
     PP1Y_AT35701
Amino acid related enzymes [BR:npp01007]
 Aminotransferase (transaminase)
  Class III
   PP1Y_AT35701
SSDB
Motif
Pfam: Aminotran_3 Serine_rich Aminotran_5 Cys_Met_Meta_PP
Other DBs
NCBI-ProteinID: CCA94289
UniProt: F6IJN5
LinkDB
Position
complement(3748917..3750107)
AA seq 396 aa
MSITPLMPVYPRCGVRPVRGEHCHLISEDGRRFLDFASGIAVNALGHSHKGLIGALQKQA
ETLMHVSNLYGSPQGEAIAQRLVDLTFADTVFFTNSGAEAVECAIKTARAYHQSVGNDGK
YELITFNNAFHGRTMATISASSQEKMHKGFLPLLPGFKYVDFNDLEAAKAAIGPNTAGFL
VEPIQGEGGIRIADEAFLQGLRQLCDEHDLMLVLDEVQSGVGRSGTLYAYEQYGIEPDIM
ATAKGIGGGFPVGACLATEKAARGMVAGTHGSTYGGNPFAMAAIGAVLDVIADDEFLEGV
RATGERLKARLEQFIGNYPDLFELVRGRGLFIGLKMKVEPRPFVAHMRDNQQVLAVSAGD
NVVRVLPPLVIDDSHIDEFMEKLSAAAASYNPEEVS
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgtcgatcaccccgctgatgcccgtatacccccggtgcggagttcggcccgttcgcggc
gaacactgccatctgatcagcgaagatggtcggcgattcctcgatttcgccagcggcatc
gcggtcaatgccctcggtcattcgcacaagggcctgatcggagcgctgcagaagcaggca
gagacgctgatgcatgtctcgaacctctatggcagcccccagggcgaagccattgcgcag
cggctggtggacctgaccttcgccgatacggtgttcttcaccaattcgggcgccgaggcg
gtcgaatgcgcgataaagacggcgcgtgcctatcaccagtcggtcggcaacgatgggaaa
tatgaactcatcaccttcaacaatgccttccacggccgcacgatggcgacgatcagcgcg
tccagccaggaaaagatgcacaagggttttctgcccctcctgcccggcttcaagtacgtc
gattttaacgatcttgaagccgcaaaagccgcgatcgggccgaacacggccggattcctg
gtagagccgatacagggcgaaggcggcatccgcatcgccgacgaggctttcctgcagggc
ctgcgtcagctttgcgacgaacatgacctcatgctcgtactcgacgaagtgcagagcggt
gtgggccgttcgggcacgctctatgcctacgaacagtacggtatcgagccggacatcatg
gcgacggccaagggcatcggcggcggcttcccggttggcgcctgccttgccaccgaaaag
gctgcccgcggcatggtcgcaggaacacacggttcgacctacggcggcaaccctttcgca
atggccgcgattggtgcagtgctcgacgtgatcgccgacgatgagttccttgaaggcgtg
cgcgcgacgggtgagcgactgaaggcgcgtctcgaacagttcatcggcaactatccggat
ctcttcgaattggttcgtggtcgcggcctgttcatcgggctcaagatgaaggtcgagcca
cgtcccttcgtggcgcacatgcgcgacaatcagcaggtgctggcagtttcggccggcgac
aacgtggtgcgcgtgctgccgccgctcgtgatcgatgacagccacatcgacgaattcatg
gaaaagctgtccgccgcagcggccagctacaatcccgaagaggtatcctga

DBGET integrated database retrieval system