KEGG   Nanorana parkeri: 108785450
Entry
108785450         CDS       T04897                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
npr  Nanorana parkeri
Pathway
npr04068  FoxO signaling pathway
npr04110  Cell cycle
npr04115  p53 signaling pathway
npr04218  Cellular senescence
npr04310  Wnt signaling pathway
npr04340  Hedgehog signaling pathway
npr04371  Apelin signaling pathway
npr04510  Focal adhesion
npr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    108785450 (CCND1)
   04340 Hedgehog signaling pathway
    108785450 (CCND1)
   04371 Apelin signaling pathway
    108785450 (CCND1)
   04068 FoxO signaling pathway
    108785450 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108785450 (CCND1)
   04115 p53 signaling pathway
    108785450 (CCND1)
   04218 Cellular senescence
    108785450 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    108785450 (CCND1)
   04530 Tight junction
    108785450 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 108785450
NCBI-ProteinID: XP_018410022
LinkDB
Position
Unknown
AA seq 291 aa
MELLCCEVDTIRRAHLDRNLLTERVLTTMLKAEETCCPSANYFKCVQKEILPYMRKIVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLSVEPLKKSRLQLLGATCMFLASKMKETIPLTAE
KLCIYTDNSIRPEELLLMELVILNKLKWDMASVTPHDFIEHFLNKMSLTEDTKQIIRKHA
QTFVALCATDVKFISHPPSMIAAGSVAAAIQGLNLGTTDSILSSQCLTVFLSQVIKCDPD
CLRACQEQIELLLESSLRQASQQINITSDTKSGVEDTDLSCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacacgatccggagagcccatctggaccggaacctg
ctgaccgagcgggtcctgacaaccatgctgaaagccgaggaaacttgctgcccgtccgcc
aactacttcaaatgtgtccagaaggagatcctcccgtacatgaggaagatcgtggccaca
tggatgctggaggtctgcgaggaacagaagtgtgaagaggaagtcttcccccttgccatg
aactatctggatcgctttctgtccgtggagcccctgaagaagagcagattgcaactcctt
ggggcgacgtgcatgtttttagcgtccaaaatgaaggagaccatccctttaacggcggaa
aaactttgtatttacacagataattccatcagaccagaggaattgctgttaatggagctg
gtaatcctgaataagctgaaatgggacatggcttctgtcacccctcacgactttattgaa
cattttcttaacaaaatgtcactgactgaggacaccaagcaaatcatccgcaaacacgcc
cagacttttgtggctctctgcgctacagatgtaaagttcatatcacatcctccatctatg
atcgcagcaggaagcgtagcagccgccatacagggtctcaatttgggcaccacagacagc
atcctatcctctcagtgcctcacagtcttcttatcacaggtcatcaaatgtgacccggac
tgtttacgggcctgccaagaacagattgagctgcttttggagtcaagtttgcgtcaagca
tcccaacagatcaatatcacctcagacacaaagtccggggtggaggatacggatctttcc
tgtaccccaaccgacgtccgggatgtgaacatctga

DBGET integrated database retrieval system