KEGG   Nanorana parkeri: 108787228
Entry
108787228         CDS       T04897                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108787228 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    108787228 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:npr04052]
    108787228 (KITLG)
Cytokines and growth factors [BR:npr04052]
 Growth factors
  Growth factors (RTK binding)
   108787228 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 108787228
NCBI-ProteinID: XP_018412224
LinkDB
Position
Unknown
AA seq 264 aa
MKKTKTWIVTCIYLQLLFICFGSPCRNPVTNAVNDIDKLVGNLPSDYIMHVKNISRNSLS
KHCWLYVMVYEMSERLGELSSKLSNTSQNYLILDSLSLIFREIRNCVKLTDQQDFVDDYL
DTVPEVTLSPRKFFNLITETISVFKEINNTHFDDTCTLPTVDPKTGDSVTKGSIQYASSK
LKNGSRPGYTDNSEFISSSSLPWTSIASIAMACMVAGFLLGIMCWKLKHQRRANNEVSEI
HADQKDTNELNNMLHQTEKEVSVI
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaagaagacaaaaacttggatcgtcacatgtatttatcttcagctgctttttatctgc
tttggaagtccgtgcagaaatcctgtcactaatgctgtgaatgacattgacaaactggtt
ggaaatctaccgagtgattacattatgcatgtgaaaaatatctccagaaacagtctgtca
aaacactgctggttatatgtaatggtgtatgaaatgtcagagcgacttggagaactttca
tccaaactctcaaacacatcacaaaattatcttatattagacagcctatctttgatattt
cgagaaatcaggaactgtgtcaagctcactgaccaacaggactttgtagatgactattta
gatactgttcctgaagtgacattatccccaaggaaattttttaatttgattactgaaact
atttcagttttcaaggaaataaataatacacactttgatgatacgtgtacactacctaca
gttgaccctaagacaggggactctgttactaagggaagcatacagtatgcttcaagtaaa
ttaaaaaatggcagcaggcctggatacacagacaatagtgaatttatcagcagttcttcc
ttaccatggactagcatagcatctatagcaatggcctgtatggtcgctggatttttactt
ggcataatgtgctggaagttaaaacaccaaagaagggcaaataatgaagtatctgagatc
cacgctgatcaaaaagacacaaatgaattaaacaacatgctacatcagacagagaaagaa
gtctctgtaatatag

DBGET integrated database retrieval system