KEGG   Nanorana parkeri: 108794233
Entry
108794233         CDS       T04897                                 

Gene name
ASH1L
Definition
(RefSeq) histone-lysine N-methyltransferase ASH1L
  KO
K06101  [histone H3]-lysine4 N-trimethyltransferase ASH1L [EC:2.1.1.354]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108794233 (ASH1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108794233 (ASH1L)
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.354  [histone H3]-lysine4 N-trimethyltransferase
     108794233 (ASH1L)
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108794233 (ASH1L)
SSDB
Motif
Pfam: BAH SET AWS Bromodomain PHD
Other DBs
NCBI-GeneID: 108794233
NCBI-ProteinID: XP_018420740
LinkDB
Position
Unknown
AA seq 2662 aa
MSGMDHRNLAMLGVGSDPEGPVNPPSAATSLDNKEQSTESGPSQDPQHFSITQTDFSEGN
VRLKIGLQAKRTKKPPKNLENYVCRPAIRTSIKQTRKSRKMTEEGSEEDSSRLSKKSADN
PSHDGLKVECLHARTKEEKVPTTKNSSPLHSEATELNKASPPRLVGNKDPDSKDRVPVNG
TAARVTEKLAQLIATCPPSKSSKIRAKKQVSSAPVSLPLEERATPNDDSPATGRLCSPSK
SRGSDERMNSQASERVDGRQAKDSILEKFCIRKEGSAGEKDKFNDRTSVPVVKSSLSEKG
VPDTDMQEKLCPVYCTSLDHRKGGASDASAAVSPFSAVGEGNLPSPAPATSLTSSSRSSN
VNCPQSPSSSLHLNPDTTRVECIDEPSDKSKFTSDTLPANRARKTPQSSLDFLQNEKTSK
EVKSVPSENLRTYIPAVPDRKPTQRVEPGSHRSDPSVVSFASLLRKKQLVKVGSLSEKPP
YSSQHGSTNSQIKHFKKRKGKKPRWTKVSNKTTQPSKVSPEHDVVRPVSMGNDKSQRGTP
EKIVGKMSLLGQVSKSSLSKASISSEGAANGMHKPTPKLYSSHSNYRMVCMSADGSDAYK
PKRGKPKSKAMPHLEGPPKRALKIPAFKVASSQSKEDQGPPVLQPEVEMPPLKTNLPRPV
FPRKRGRPRRDAAAPMRTPPVLSVAPFLVTDNHKQTECENEKHQNDEHFNSRLHPDDAGS
NCSDPDRKFVKKSNGQLVKNIIRKINKMKTIKRKKLLSQILSGAAEQNSRGKAQTKLQGT
VSTLAATFTSKLGQQINVSKKGTIYMGKRRGRKPKSTSESVMTKNSVSSPALEKSGQQDA
HTLGQAVAPIISQNLSGSEVLPSPACSLSPGASGAQSPMSSDASFVEPNPVPYSHTHSRQ
GTFLQTLAMRKASKDCRQLSPPNLLPNSPSHLNEIPSLKEATSSPISESHSDETIPSDSG
IGTDNNSTSDRAEKFCAQKKRRHSFEHISLLAPQTLPVLSSLKEKHKHKCKHRSHEYLSY
DKLKRQKRKRKKKYPQLRARQDPDFLAELEELITRLSEIHISHRSHHFIPRDLLPTIFRL
NFNSFYSHPTFPLDPLHYIRKPDLKKKRGRPPKMRESMSEVPFVHSLGFPLSSTGFYPSY
SMPYSPSPITAAPIGLSYYGRYPPTLYPPPPSPSFTTPMHPPSYMHTGHLLLNPAKFHKK
KHKLLRQEAFLTTSRTPLLPVGTYPSVPPDMAYGWMVEHKHRHRHKHREHRSDQQQLSMD
SLAGVGSSRSVLESLKRYRFGKDNISDRYKHKDKHRCHLPCSHLTPSKGLLSREEQWVRR
EAPESGSLTLGLQTPLQIDCSNSSPSLSLSGFTSSSEPASSDEHTNLFTSAIGNCRGSMS
ANVGCKTLSDGPAFFTDSRSVRKEAAQSSSASQERSLRTPDSSSYSPSRRRTASESTSCS
VMGVPLRGLRHSSTAEESVDCLLQRTVDDNLTSSTPSTNSPARAHSREKGQSRSDNMLVS
TPAVDSPNDGLSSSSGRLPSLKRSVVEAIHKQARRMYNYDTILSSKKNLDHVNKILKAKK
LQRQSRTGNNIVKRRPGRPRKYPLDAVLAMPLVSHQETINDRSDTVTDVIEAVVQGVNLT
TEHRKGWKRKHLGVEKLRKRLRTSLDEDQESSTSLAEIAFADDSSSRDLPLSHEERVDAF
SRHLAPLMQREKKTARPPKKKYQKAGLFSDVYKTTDPKSRLVQLKKEKLEYNPKEHEYGL
LPAPIHIGKYLRHKRSDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYE
ATTCNCRKPNNHDDWGCAEDCLNRMIFAECSPNTCPCGEHCSNQRIQRHEWVQCLERFRA
EGKGWGIRTKEPLRSSQFIIEYLGEVVSEQEFRNRMIEQYHNHNDHYCLSLDSGMVIDSY
RMGNESRFINHSCDPNCEMQKWAVNGVYRIGLYALKDMPAGTELTYDYNFHAFNTERQQL
CKCGFDRCRGIIGGKSQRMNGQTNKAGHQIPSHRRLGRSKEKRKSKHRLKRRRGHHSDDR
SESVGASNRLSSQLHMKPMSNRERNFVLKHRVFLIRNWEKTRRRHEEVKNDLNAASLYNR
WNGVCRDDGNIKADVFMTQFAALQTSRSVRTRRLAAAEENIEVARAARLAQIFKEICDGI
VCYKDSLNRNLAAPLLSLPPKKKNPYYYEKVGDPLDLLTIEKQILSGHYKTVEAFDTDML
KVFRNAEKYHGRKSAIGRDVCRMRKAYYSARHESSAQIDEIMGETASEADSSETLSCDKD
GGNEKEDDIIRCICGLYKDEGLMIQCEKCMVWQHCDCMGVTSDVEHYLCEQCDPRPVDQE
VPMIPCPHYAQPGFIYFICLLRDDLLLRQGDCVYLMRDSRRTPDGQPVRQSYRLLSHINR
DKLDIFRIEKLWKNEKGERFAFGHHYFRPHETHHAPSRRFYHNELFRMPLYEIIPLEAVV
GTCCVLDLYTYCKGRPKGAKEQDVFICDYRLDKSAHLFYKIHRNRYPVCTKSYAFDHFSK
KLTPKRDFSPHYVPDNYKRNGGRSSWKSERPKPPSADLPQEDPMPLMEDLMVNHEPAVQE
ESEMGSTEGGESTTVENNSPPQRLCSPERQQVKRDKLNQILLSLLDKLPSKNAIDVTYLL
EEGPCRKLRRRTLNLPECIFRK
NT seq 7989 nt   +upstreamnt  +downstreamnt
atgtctggaatggaccataggaatctggctatgttaggagtaggatctgatccagaaggg
cctgtgaaccccccctctgcagccaccagcttggacaacaaggagcaaagcacggaaagc
ggccccagccaagacccacagcacttttccatcacccagacggacttctctgagggaaac
gtacgtctaaagatcggactgcaggccaaaaggactaagaagcccccgaaaaacctggag
aactatgtgtgtcggcctgcaataagaaccagcataaagcagacgcggaagagcagaaag
atgaccgaggagggcagtgaagaggactcttccagattgtcgaagaagtctgcagacaac
ccaagccatgacggcctgaaggtagaatgtttacatgctcgcaccaaggaggagaaggtc
cccacaacaaagaattcttcacctttgcactcagaagcgactgagctcaacaaggcatcg
ccacctagacttgtcggtaacaaagaccctgactcaaaggacagggtaccggtgaatggc
acagctgcccgtgttactgaaaaactcgctcagctcattgcaacatgccctccttccaag
tcttccaaaatcagagccaaaaagcaggtatcgtcagccccagtcagcttgcccttggaa
gaacgggcaacgccgaatgatgactctcctgcgacagggcgtttatgctctccttccaaa
tccaggggctccgatgaaagaatgaacagtcaagcttcggaaagggttgacggacggcag
gccaaggacagcatcttagaaaagttctgtatcaggaaagagggatccgctggcgagaaa
gataaatttaatgacaggacttctgtcccagtggtaaaaagttccctctctgagaaaggt
gtccccgatacggacatgcaagaaaagctttgccctgtgtattgcacttcattggaccat
cggaaggggggtgcgtctgatgcatcagcagccgtgtcgcctttcagtgctgtcggggaa
ggaaatctcccttcgccagcaccagcgacgtctctgacatcatccagtaggagttcaaat
gtgaattgtccccaatccccctcaagttcattgcacttaaaccctgacacgacgcgtgtg
gaatgtattgatgagccaagcgacaaaagcaagtttacatccgacactttacccgctaac
agggctcgtaaaacccctcaaagctctctggacttcttgcagaatgaaaaaacgagtaaa
gaggtcaaaagtgtccccagtgagaatttaaggacttatattcccgctgtaccagacaga
aagcccacacagagagtggagccaggcagccaccggtcagacccgtctgttgtcagtttt
gcaagtttacttaggaaaaaacagttagtgaaggttggcagcctctcggaaaagccgcct
tacagcagccaacatggcagcaccaactcacagataaaacactttaagaaaaggaagggt
aagaagcctcggtggactaaagtgtctaacaaaaccactcagccctcaaaagtatcacct
gagcatgatgtggtaagaccagtatcgatggggaacgataagtcccagcggggcacaccg
gagaaaattgtggggaaaatgtcacttctcggtcaagtttccaagtcctcattgtccaaa
gcaagcatttccagtgagggagccgccaatggaatgcacaagccgactcctaagctgtat
agttcccatagtaattatagaatggtttgtatgtccgcagacggttccgatgcttacaaa
cctaagagaggaaagcccaaaagtaaggctatgccacatctggaaggtcccccaaaaaga
gcacttaaaatcccagcttttaaagtagcctcatcacaatccaaagaagatcaggggcct
cctgttctccagccagaggtcgagatgccacctctgaaaacaaatcttcccagaccggtg
ttcccgaggaagagaggccgaccgagaagggatgcggctgcaccgatgcgaacaccaccc
gtcctttctgtcgcgcctttccttgtgaccgataatcacaagcaaaccgagtgcgaaaac
gagaagcaccaaaacgatgagcatttcaacagcaggctccacccagacgacgcaggcagc
aattgctcagatccggataggaagtttgtaaagaaaagtaacgggcagctagtgaagaat
attattcgaaagataaataagatgaaaactattaagcggaagaagctgctgagtcagatt
ctttccggtgcagccgaacaaaactccagagggaaggctcaaacaaagctgcaaggtacg
gtttcaacacttgccgccacgtttacttcgaaattaggtcagcagataaatgtcagcaag
aaagggaccatctacatgggcaagagaagaggcaggaaaccgaagtcaacgtccgaaagt
gtcatgaccaaaaattcagtcagctctccagcattagaaaaaagtggtcagcaagatgct
cacactttaggtcaagctgtggcacccatcatatctcagaacctatctggctctgaggtt
cttccttcaccagcttgttccctctcgccgggagccagcggtgcccagagtcccatgagc
agcgacgccagttttgtagagccaaaccctgtgccatattcccacacgcactccagacaa
ggtacctttctacagacacttgccatgaggaaagcctccaaggactgtaggcaactgtca
cccccaaatctgctgccaaactctccctcccacttaaatgaaatcccttccttaaaagaa
gcaacttcttctcccatcagcgagtctcacagcgatgaaaccatccccagcgacagcggc
atcgggacagacaacaatagcacgtcagaccgggccgagaagttttgtgcgcagaagaag
agacgacattctttcgaacacatttctcttttagctcctcagaccttgccggttctcagc
agcctcaaagagaaacacaagcacaaatgtaagcacaggagtcacgagtatctcagttac
gacaaactcaaaaggcaaaagcggaagcgtaaaaagaagtacccgcagctgcgcgctcgg
caggatccggacttcctggccgagttggaggagctgatcacgcgcttgagcgaaatccac
atttctcataggagtcaccatttcatcccaagagatctgcttcctactatatttcgcctc
aactttaacagcttttatagtcacccgacatttcctttggatcctttgcactacatccgg
aaaccggatttgaaaaagaagagagggcggccgcccaagatgcgggaatctatgtcggag
gtgccatttgtgcacagtcttggttttcccctctctagcactggcttctacccttcatac
agcatgccttactcaccctcccccattactgccgcccccattggcttaagttattatgga
cgatacccccctactctgtaccctcctccaccctctccttccttcaccaccccaatgcac
ccaccttcgtacatgcatactggccatttattgcttaaccctgccaaatttcataagaaa
aaacacaagctccttcgacaagaggcattcttgaccaccagccgcacccctctccttcct
gtgggcacataccccagcgtcccaccagacatggcttatggctggatggttgagcacaaa
caccgccaccgccacaagcaccgcgaacaccgatcagaccagcaacagctttcaatggat
tccttggctggggtcggatcttcaaggtcagtcctggagtctttaaaacgttacaggttt
gggaaagacaatattagtgacaggtacaaacacaaagacaaacacaggtgtcacttacct
tgcagtcacctgactccttccaagggactgctgagtagagaggagcagtgggtccggaga
gaggcccccgagtcgggctcgctgactttgggacttcagactccattgcagattgactgt
tcaaacagctcaccgagtctctcgctcagtggcttcacttccagctctgagccagctagc
agcgatgaacacaccaacctttttacaagtgcaataggcaactgtcgaggcagcatgtct
gccaacgtcgggtgcaaaacgctaagcgatggcccagccttttttacagatagcagatca
gtgaggaaggaggctgctcagtcatcatcagcttcccaggagcgtagtctgaggacacca
gatagctccagctatagtccctctagaagaaggacggcatctgagagcacttcatgttca
gtcatgggggtcccattgcgaggcctgcggcacagttctacagcggaggagtctgtggat
tgtttgctgcagcgcacagtggatgacaacctcacctcctctactccttccaccaacagc
cccgccagggcgcacagcagggagaaaggacagagcaggtcggacaatatgcttgtttca
acacctgccgtggactctcctaacgatggcctcagctcatcttctggtcgtctgccaagc
ctaaaaagaagcgtggttgaggccatacacaaacaggctcggaggatgtacaactatgat
acaattctgtcctctaaaaagaacctggaccacgttaataaaatcctaaaggccaagaaa
ctgcagagacagtcccgcacaggaaacaacattgtgaagaggaggccggggagacccagg
aagtatcctctagacgcggttttggccatgccgctggtcagccatcaggagactatcaat
gacagatcagacacggtgacagacgtcatcgaggctgtagtgcagggggtgaatctgacc
actgaacaccgcaaggggtggaagaggaagcatttgggcgtggaaaagctaaggaagcgt
ttgaggacctcactggatgaagaccaggagagcagcacaagtctggccgagattgctttt
gcagatgactcttccagccgtgacctccccctgagtcacgaagaaagagtggatgctttt
tcccgtcacctggcaccactcatgcagcgggagaagaagactgcacgtcctcccaaaaag
aaataccaaaaggctggacttttctctgacgtgtataaaaccacagacccgaagagtcgt
ctggtacagctgaagaaggaaaaattggaatataacccaaaagagcatgagtatggtctg
ctgcctgcacccatccatattgggaaatatctccgacataagaggagcgacttccagcta
ccatatgacatcttgtggcagtggaaacacaaccagttgtataagaagccggatgtcccc
ctgtacaagaagatccgatccaatgtgtatgtggatgtgaagccgctgtctggatacgag
gccaccacctgtaactgcaggaagcccaataatcatgatgactggggctgcgctgaggac
tgcctgaaccggatgatatttgcagagtgttccccgaacacatgtccttgtggagagcat
tgcagcaaccagcgaatccagagacacgagtgggtccagtgcctggagcgattccgggct
gaggggaagggatggggaatccgcacgaaggagccactgaggtcttcgcagttcatcatc
gagtatcttggggaagtggttagcgagcaagagttcagaaatcggatgattgaacagtac
cacaaccacaatgaccactattgccttagcttggactccggcatggtgattgacagctac
cgtatgggcaacgagtccagattcatcaaccatagctgtgacccgaactgcgagatgcag
aaatgggctgtgaatggagtataccgcattgggctgtacgctttaaaggacatgccagca
ggtaccgaactgacttacgactacaacttccatgcgtttaatactgagaggcagcaattg
tgtaagtgtggctttgaccggtgtcgggggatcatcggtgggaagagtcagagaatgaac
gggcagacaaacaaagccggccaccagattccttctcaccggagacttggacgctccaaa
gaaaagagaaagtccaagcaccggctgaagaggaggaggggtcaccacagtgatgatcgc
agtgaaagtgtcggggcatcgaacagactcagctcccagctccacatgaaacctatgtcc
aacagagagaggaactttgtgttgaagcacagagtattcttgatacgaaactgggaaaaa
acccgccggcgacatgaagaggtaaaaaatgacctgaatgcagcatcgctgtataaccgc
tggaacggtgtgtgcagggatgatggaaacatcaaagctgatgtcttcatgacccagttt
gctgctctacagacctctcggtcagtacgtacccgccggctggctgccgccgaggagaac
attgaggtagcacgtgctgcccgtctggcacagatcttcaaagagatctgtgatggaatt
gtctgttataaagattccttgaacagaaacctggcggcccccctgcttagtcttccaccc
aagaaaaagaacccatactactacgagaaggtgggggatccactggatttgctgactatt
gagaagcagattcttagcggacattataaaacggttgaagcttttgacacggacatgctg
aaggttttccgcaatgcagagaaatatcacgggaggaagtcggccattggccgtgacgtg
tgccggatgaggaaagcatattacagcgcacgccatgagtcctctgcacaaattgatgaa
atcatgggggagacagcaagcgaggcggacagcagcgagaccttgtcatgtgataaagat
ggtggaaacgagaaggaggatgacatcatccgctgtatctgcggcctctataaggacgag
gggctgatgattcagtgcgaaaagtgtatggtctggcagcactgtgactgtatgggagtg
acgtcagacgtggaacattatctgtgtgagcagtgtgacccgcggccggtcgatcaggaa
gttcccatgatcccatgtcctcattacgctcagccgggtttcatctatttcatctgcctt
ctgcgtgacgatctgcttctccgacaaggggactgtgtgtatctcatgagagacagccgg
cggacaccagacggacagccggtgcggcaatcttatcggctcttgtctcacattaatcgc
gacaaacttgatatcttccgcatagaaaagctgtggaaaaacgagaagggtgagcgattc
gccttcggccaccattacttccgaccccacgagacacaccacgcgccatcacgcaggttt
taccacaacgagcttttccgcatgccgctgtatgaaatcatcccactggaggcagtggtg
gggacctgctgcgtgttggacctgtatacatactgcaaaggccggccaaagggagcgaag
gaacaagacgtttttatctgcgactacaggctggataaatcggcgcacttattctacaaa
atccaccggaatcgctacccggtctgcactaagagctacgcctttgaccacttctccaag
aagctgacgccaaaaagagatttctctcctcactatgtgccagataattacaaacggaac
ggaggcaggtcatcatggaagtccgaacgccccaaaccccccagcgcagacctccctcag
gaggacccaatgcccctcatggaggatttaatggtgaaccatgagccagcggtacaggag
gagtcagagatgggctccacagagggtggagagagcaccacggtagagaataacagcccc
ccgcaacgtctctgctccccggagagacagcaagtgaaaagggacaaactgaaccagatc
ctcctcagcctgctggacaaactacccagcaagaatgccatcgatgtgacgtatctgctg
gaagagggtccctgcaggaagctgaggagacgcacacttaatctgcctgaatgcatcttc
agaaagtga

DBGET integrated database retrieval system