KEGG   Nanorana parkeri: 108794559
Entry
108794559         CDS       T04897                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108794559 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    108794559 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:npr04052]
    108794559 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:npr00536]
    108794559 (FGF1)
Cytokines and growth factors [BR:npr04052]
 Growth factors
  Growth factors (RTK binding)
   108794559 (FGF1)
Glycosaminoglycan binding proteins [BR:npr00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   108794559 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 108794559
NCBI-ProteinID: XP_018421127
LinkDB
Position
Unknown
AA seq 155 aa
MAEGDITTFRAVTEKFNLPMGNYQQPKLLYCRNGGYFLRILPDGAVDGTRDRDDLNIQLQ
LSTESIGVVYIKNADTGNYLAMNESGLLYGSMTVNEECLFLETIEENNYNTYKSKKYSEL
SWFIGIKKNGTCKRGSRTHYGQNAILFLPLSVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcggaaggagatatcaccactttcagagctgtgactgagaagtttaacctcccaatg
ggaaactaccagcaaccaaaacttctctactgcagaaatggtggatacttcttacgcata
cttccagatggagccgtggatgggacaagagacagagatgacctcaacattcagttgcag
ctaagcacagaaagcattggtgtggtttatatcaagaatgctgatactgggaattacttg
gctatgaacgaaagtgggcttttatatggatctatgacggtgaatgaggaatgcctgttt
ttggagactatagaggagaacaactacaatacatacaagtcaaaaaaatactcagagttg
agctggtttattggcattaagaagaacgggacatgcaaacgtggttcacggactcactac
ggccaaaacgccatcctgttccttccattatcagtgtcaagtgactag

DBGET integrated database retrieval system