KEGG   Nanorana parkeri: 108796895Help
Entry
108796895         CDS       T04897                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
npr  Nanorana parkeri
Pathway
npr03030  DNA replication
npr03410  Base excision repair
npr03420  Nucleotide excision repair
npr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:npr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    108796895 (LIG1)
   03410 Base excision repair
    108796895 (LIG1)
   03420 Nucleotide excision repair
    108796895 (LIG1)
   03430 Mismatch repair
    108796895 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:npr03032]
    108796895 (LIG1)
   03400 DNA repair and recombination proteins [BR:npr03400]
    108796895 (LIG1)
Enzymes [BR:npr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     108796895 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     108796895 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     108796895 (LIG1)
DNA replication proteins [BR:npr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    108796895 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     108796895 (LIG1)
DNA repair and recombination proteins [BR:npr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     108796895 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     108796895 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     108796895 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 108796895
NCBI-ProteinID: XP_018423955
LinkDB All DBs
Position
Unknown
AA seq 989 aa AA seqDB search
MQRSIKSFFQPKPGGAIKKEEKKKDHGSRKEKCTTTSKNGGEHPLKERNGTTLVSDSDSP
VKRIPKKITRVLDSDEEETMDFETTEPTKDNSEASQKEKPATPPVAVSGEGGNGDSSEKS
SNAASPDASVTASNIPKRKTARKQITKRKLENISEQDKQDQELNDKEATAKRQKKEADEG
LSPKNSESGKESEQCAMDTSPEKTKTPVNKSAVKSEPEEETGQCTTDSSPKKTEEKTGAS
PSSGNSKKGKGKSDKFFEKKGKKVSEKKTKNQSSEKESEDMSDKHSEEESKVSEKTSEKE
VSEKTTEKSSANTPAKPTKNISSFFGATKQDVADQQADYSPSKNSYHPVNDACWTNGQMV
PYLAVARTFEMIEDESARLKNIETLSNFLRSVICLSPGDLLPCIYLCLNRLGPAYEGLEL
GLGETILMKAIAQATGRQLDKIKAEAQEKGDLGLVAESSRSNQRTMFTPPKLTVLGVFNK
LKEIAKMTGNASMNKKIDVIKGLFVACRHSEARYIARSLGGKLRIGLAELSVLAAISQAV
CLTPPGQEFPPAVIDASKGMSTEAKKAWIEEHSLILKQTFCELPNYDAVIPALLKHGIKE
LPQHCHLTPGVPLKPMLAHPTKGVGEVLKRFEEAAFTSEYKYDGERAQIHILENGEVHVY
SRNQENNTSKYPDIIGRIPKVKKDSVKSCIIDSEAVAWDPQKKQIQPFQVLTTRKRKDVE
ASEIKVQVCVYAFDMLYLNGESLVREPFSRRRQLLRESFQEVEGEFMFATYMDTSNTDEI
SEFLDQSIKDSCEGLMVKTLEENATYEIAKRSHNWLKIKKDYLEGLGDTLDLVVIGAYLG
KGKRTGKYGGFLLASYDEESEEYQTICKIGTGFTDEDLETHYNFLKDHVIDGARSYYRWD
SSTQPDHWLEPVQVWEVKCADLSISPVHKAALGLVEDEKGISLRFPRFLRIRDDKKPEEA
TNSYQVAELYKKQQQIQNTSAEKGDDDFY
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgcagcggtcaataaagtcatttttccagcctaaaccaggaggggctataaagaaggaa
gagaaaaaaaaagatcatggttctcgaaaagagaaatgtactactaccagtaaaaatggc
ggggaacatccattaaaagagagaaatggtacaaccctggtcagtgattccgattctcct
gtaaaacgtattccaaagaagattacacgggtattggacagtgatgaggaagagactatg
gattttgaaaccacagaacccacaaaagataattctgaagcaagtcaaaaagaaaagcca
gctactccaccagttgctgtttcaggggaaggtggaaatggggattccagtgaaaaatcc
tccaatgctgcttcaccagatgcttctgttactgcttccaacattcccaaacgcaaaaca
gctcgcaagcagataaccaaaagaaaattagaaaatatttcagaacaagataaacaggat
caagagttgaatgacaaagaggcaactgccaagcgtcaaaagaaagaggcagatgaagga
ttgtctcccaagaactctgaatcaggcaaagagagcgaacaatgtgccatggacacatca
cctgaaaagacaaaaacacctgttaataaatctgcagttaagtctgaacctgaagaagag
actggacaatgtaccacagactcatcacctaaaaagactgaagaaaaaacaggtgcaagt
ccatcttctggcaactcaaaaaagggtaaaggaaagtcagacaaattctttgaaaagaag
ggtaaaaaagtttcagagaaaaagactaaaaatcaatcatctgaaaaagagagtgaagac
atgtctgacaaacactcagaggaagagagtaaagtctctgaaaaaacttctgaaaaagaa
gtttctgaaaagactactgagaagtcctcagctaacactcctgcaaagcccaccaaaaat
atttcaagcttctttggagccaccaagcaagatgttgcagaccaacaggcagattacagt
ccatcaaaaaatagttatcatccagtaaatgatgcctgctggactaatggccagatggtt
ccatacctggcagttgcacgcacctttgaaatgattgaagatgaatctgcacgcttaaag
aacatagagactcttagtaattttctgcgttctgttatctgtctgtctccgggggatctt
ttgccttgtatctacctctgtttgaaccgcttgggtcctgcttatgaagggcttgaactt
ggtttaggagaaactatattaatgaaagcgattgcacaagcgactgggcgtcagttagat
aaaattaaagctgaggcacaagaaaagggggatcttggacttgttgcggagagcagccga
agtaaccagcgcaccatgttcacaccaccaaaacttactgttttgggcgtctttaacaag
ctgaaagagattgccaagatgactggtaatgcttctatgaataagaaaattgatgtcatt
aaaggcttgtttgtggcatgcaggcattctgaagcacgttacattgctagatctttagga
ggaaaacttcgaataggattggcggagctatctgttctggcagctatctcacaggctgtg
tgccttacaccaccaggccaagagtttccacctgctgtgatagatgcctcaaaggggatg
agcacagaggctaaaaaagcatggattgaggagcattctttgatcctgaagcagacattc
tgtgagttaccaaactatgatgccgttattccagcacttctgaagcatggaattaaggag
cttccccaacattgccaccttactccaggggtcccattaaagccaatgttggcacacccg
actaagggagttggtgaagtgctgaagaggtttgaagaagctgcttttacctctgaatat
aaatatgatggagagcgtgcacagatacatattctggagaatggagaagtgcacgtatac
agcagaaatcaggaaaacaatacatcaaaatatccggacataatcggcagaattcccaag
gtaaagaaagacagtgtaaagtcttgtatcattgattcagaggctgttgcatgggaccca
cagaaaaagcagatccagcccttccaagtgctcactactagaaaacgaaaggatgtggaa
gcttcagaaataaaagtccaagtgtgtgtgtatgcttttgacatgctgtatttaaatgga
gagtctctagttagagaaccattttctagaagacgccagctactaagagagtcttttcaa
gaggtggaaggagaattcatgtttgctacatatatggacacatcaaacacagatgaaata
tcagagtttcttgatcagtcaattaaagattcttgtgaaggcctgatggtaaaaactcta
gaggagaatgccacatatgaaattgcaaagcgttcccacaattggttaaagataaagaaa
gattacttggagggattaggagacactttggatctggttgttattggtgcctatttgggg
aaaggaaagcgaactgggaaatatggaggctttttactggcatcatatgatgaagagagt
gaagaatatcagacgatatgcaagattggaacaggtttcacggatgaggatttggaaacc
cactacaatttcctgaaggaccatgtcattgacggagcacgcagctactaccgctgggac
agttcaacacagccagatcactggcttgagcctgtgcaagtttgggaagtgaagtgtgca
gacctttcaatctctcctgtacataaagctgcactaggactggtggaggatgaaaaggga
atttcactacgcttcccacgttttcttcgaattcgagatgataaaaagccagaagaagct
acaaacagttatcaggttgccgagctttataagaaacaacaacaaatacagaacacatct
gcagagaaaggagatgatgatttctactag

DBGET integrated database retrieval system