KEGG   Nanorana parkeri: 108797472Help
Entry
108797472         CDS       T04897                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
npr  Nanorana parkeri
Pathway
npr00480  Glutathione metabolism
npr00980  Metabolism of xenobiotics by cytochrome P450
npr00982  Drug metabolism - cytochrome P450
npr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108797472
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108797472
   00982 Drug metabolism - cytochrome P450
    108797472
   00983 Drug metabolism - other enzymes
    108797472
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:npr02000]
    108797472
Enzymes [BR:npr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108797472
Transporters [BR:npr02000]
 Other Transporters
  Pores ion channels [TC:1]
   108797472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 108797472
NCBI-ProteinID: XP_018424573
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MSGSQRSLAKGSAAPGPVPQGLLRLYSMRFCPYAQRARLVLAAKGIKHEVVNINLKNKPD
WFFEKSPLGLVPSIETSDGKIIYESPIVCEYLDEAFPEVKLIPSDPYAKAEQKMLLETFT
AVTPVFYKIFIAHEKNEDTTELKSKFLEILKKLEEALIKKNTPYFGGESVSYIDYMVWPW
FEKFGLFGLKSLVDETPNVKAWQDRMLQDPAVTATYTEPEVVLAFSKLYMQNSLEAADYG
LD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtccggctctcagagaagtttggctaaaggcagtgccgccccagggccagtaccacaa
gggttgcttcgactgtacagtatgaggttctgcccctatgcccagagagcaagactcgtt
ctggccgctaaaggaatcaagcatgaagtggtaaacatcaatctgaagaacaaaccagac
tggttttttgagaagagtcctctgggtctggtaccttccattgagacttctgatgggaaa
ataatatatgaatcgccaattgtttgtgaatacctggatgaagcctttcctgaggtgaag
ctgattccatctgacccttatgcaaaagctgaacagaagatgttgctggaaactttcact
gcagtcacacctgtattttacaagattttcattgcacatgaaaaaaatgaagacacaaca
gaattaaaatcaaagttcttggagattttaaaaaaactggaagaggctctgattaagaag
aacacgccctactttggtggtgaatctgtatcctatattgactacatggtatggccctgg
tttgagaaatttggtctttttggattaaaaagtcttgtggatgagaccccaaacgtcaaa
gcttggcaggatcgtatgctacaagacccagctgtcacagcaacctacactgagccagaa
gtcgtcttggcattttccaagctctacatgcagaacagtttggaagctgctgattatggc
cttgactaa

DBGET integrated database retrieval system