KEGG   Nanorana parkeri: 108801355
Entry
108801355         CDS       T04897                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like
  KO
K11427  [histone H3]-lysine79 N-trimethyltransferase [EC:2.1.1.360]
Organism
npr  Nanorana parkeri
Pathway
npr00310  Lysine degradation
npr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    108801355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:npr03036]
    108801355
Enzymes [BR:npr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.360  [histone H3]-lysine79 N-trimethyltransferase
     108801355
Chromosome and associated proteins [BR:npr03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108801355
   HMT complexes
    Dot1-containing complex
     108801355
SSDB
Motif
Pfam: DOT1
Other DBs
NCBI-GeneID: 108801355
NCBI-ProteinID: XP_018428784
LinkDB
Position
Unknown
AA seq 1331 aa
MGEKLELKLKSPVGAEPAIYPWPLPIYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKRYPTVKVTRSSLERRLNSHAIAAARKSAQGLQFLFCLAFSPCSQLDQPSMDYRL
VCLPEHCWRGTRGGINLKIILSSPEQQCWYIYIGDLTKESIKGEGGEVKRGKTVKNRKNM
EKSPTQRNFEGLPERRFFVEERHSWLASEQESGIVPVQPGRSGTEIPKSVQKASSSSGKR
RITERPPFSSDQERGESPSWKGTTHPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYE
PFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATGGKHHYGIEKAD
IPAKYAETMDKEFRKWMKWYGKKHSEYTLERGDFLSEEWRERIANTSVIFVNNFAFGPEV
DHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKP
VSYYLHTIDRTLLENYFSSLKNPKLREEQEAARRRQQREGKSNTTTPTKIQEIKDSATEE
EKPAPVKKTSPAKARRRLTKKGKKMAGRKRGRPKKLLQANGERKSSKSPTVLEVQNLQNN
PPPQSPTQPSPQDACKSPQSPHYQLPLKAQRQPSNQLMSSPTPPALQKLLDSFRVQYLQL
MSYMKTPQYKAGLQQLLQKEKVKNSQLLGAAQQLLTHCHAQKEEIKKLFQQKLDELGVKA
LTYSDLIQAQKEISSHNLQLKEQSRQLEQENGELRNHSLQLLKARCEELKLDWNTLSLEN
LMKEKLALKNQISEKQKHCLELQISIVELEKLQRQHELIQLKSSTLPDDPPPSNNRPKGS
LGARYSTDASHARVHPPQPSIPNGLSPDLSTNGHALHELYHSGRSGGSRPCSKESTPSHM
DLSDIVSNTQIHSSRHKGERTAGQSQPDYTRYSPAKIAMRRHLNQEPAPNCRNVDFSHRN
ELVKENGFMSSSPGSLNGIQLSPRESHPSPDVGQAAAERGGDKLSRDRSPLIPETITSLP
ISIPLSTVQPNKLPVSIPLASVVLPSRVEKRNSPSPGCNSRDSCSMDNQYGAANSFNYAA
VSRPLATSGFFYPTWPSSLNGPVLNSHGSETDCMDDSSNSGTLSNSGGSRSSTPHHQQSS
QRSPAHYPMSDSPHGFLDPSKTSGDGDFYASDAEVEAKRRIIFTITSGGSSSGRSPSNKH
SPLTATIRMESGPGQDGRRKGSRRKRPYAGNYSLVVSPKRRSLPSSFGLNGYTSGSPMSI
NSMVNNINQPLEITAISSPENSLKSSPAPYQDHELPPVLKKEKPLPSTNGVHYSPLTTED
EMESDEEFPNA
NT seq 3995 nt   +upstreamnt  +downstreamnt
atgggcgagaagctagaactcaagcttaaatcgccggtgggagccgagcctgccatctat
ccttggccgctgcctatctacgataagcaccatgatgctgcacatgaaattattgaaaca
attagatgggtctgtgaggagatcccagaccttaaattggccatggaaaattatgtactc
attgattatgacaccaaaaggtacccaacggtgaaggtcacgcgatcgtcattggaacgt
cgcctgaacagtcatgctatcgcggccgcgcggaaatccgcccagggactgcagttcctg
ttctgcctcgcgttttctccttgctcccaactcgatcagccgtccatggattaccgcctt
gtgtgcctcccagagcactgctggagaggcacccggggtggcattaacctgaaaataatt
ctgagctccccggaacaacaatgctggtatatatacattggtgaccttacaaaggagagt
ataaaaggggagggaggtgaggtaaagagggggaagacagtcaagaacagaaaaaacatg
gagaagtctccaacacagcgcaactttgaaggccttcccgagcggcgtttctttgtggag
gagcgccattcgtggcttgcatctgagcaggagtccggtatcgtgccagtccaaccaggt
agatccggtaccgaaatccccaagtcggtgcagaaggcctccagctcttcagggaagcgt
aggatcactgagcggcctcccttttctagcgatcaggaaagaggggaatccccatcgtgg
aaaggcaccactcatccaatgaaattaaacacccgcccgtccacaggtctcctccgccat
attttgcagcaggtctacaaccactctgttactgacccagagaagcttaataattatgag
ccattttctcctgaagtgtatggcgagacttctttcgatttggtagctcagatgattgat
gaaataaagatgacagaggacgatctctttgttgacttgggtagtggcgttgggcaggtt
gtcctgcaggttgctgcagccactggaggaaaacatcactatggaatagaaaaagctgac
atcccagccaaatatgcagaaacaatggataaagagtttagaaagtggatgaaatggtat
ggaaagaagcattcagaatatacactggaacgtggagacttcctatcagaggaatggagg
gaaaggatagccaacacaagtgttatttttgtgaataattttgcctttggtcctgaggtc
gaccaccagctaaaggagagatttgccaacatgaaggaaggtggaagaattgtttcctcc
aaaccctttgcacctcttaactttcgaattaacagtagaaacctcagtgatattggcact
ataatgagagtagttgaactgtcaccgttgaaaggttctgtctcttggaccggcaagcca
gtttcctattacctgcacaccatagaccggactttacttgaaaactacttttccagtctg
aaaaatccaaaactcagggaggaacaggaagcagctcgaagaaggcagcaacgtgaagga
aagagcaataccaccacccctacaaaaattcaggagattaaggattctgctacggaggag
gagaaaccggctcctgtgaaaaagacttcacctgccaaagctcgtaggagactgaccaag
aagggcaaaaaaatggcaggtcggaaaagaggacgtcccaagaaactgcttcaggcaaat
ggtgaacgcaaatcttccaaatcgccaactgtactggaagtccaaaatctacaaaataat
cctccgcctcagtcgccaacacagccaagccctcaggatgcctgcaagtcacctcaaagt
ccccattatcagctacctctaaaagcacagcgtcaaccttccaaccagctgatgtcttct
cctacacccccagcactgcagaagctgcttgactcatttagggtacagtacctgcaactt
atgtcttacatgaagactccccagtacaaagctggactgcagcagctgttacagaaagaa
aaggtgaaaaactcccagctgcttggtgctgcccaacaacttcttacacattgccatgct
caaaaggaagagatcaaaaaactgtttcagcagaagctggatgagctgggagtcaaggcc
cttacttatagtgatcttattcaagcccagaaggagatctcctctcacaatctgcaattg
aaggaacagagccgacagttggagcaggaaaatggtgaattgagaaaccacagtttgcag
ctgctgaaggcacgttgtgaagaattaaagctggactggaatacactgtccctggaaaat
ctgatgaaggaaaaattggcactgaaaaaccagatttcagagaagcagaagcattgcttg
gagttacagattagtattgttgagctggagaaattacaaagacagcacgagctgattcag
ctgaagtcttccactttgccagatgatcctccgccaagcaacaatcgccctaagggcagt
ttaggtgctcgctactccactgatgcatcacatgcacgtgtgcatccccctcagccctcc
attcccaatggcttaagcccagatctctccacaaatggtcatgcattgcatgagctttac
cattcaggccgcagtgggggaagtaggccttgctcaaaagagagcactccttcccatatg
gatctttctgacattgtttcaaatacacaaatacattcatcacgacacaagggagagagg
actgctggacaatctcaacctgactatacccgatactcacctgctaaaatagccatgagg
cgtcatctgaatcaagagccagcacctaactgcagaaacgttgacttcagtcacaggaat
gagttggttaaggagaacggctttatgtcatcaagtcctggtagtttgaatggcatccag
ctaagtcctcgggaatcgcatccttctcctgatgtaggccaagcagctgccgagagggga
ggtgacaagctgtcaagagaccgtagccctttgattcctgaaacaatcaccagtttgcct
ataagtatcccactgagcacagtccaacccaacaaattgccagtcagcatccctctggct
agtgttgtcctgccaagccgtgtggaaaagagaaacagtcccagtccaggttgtaatagc
agagatagctgcagcatggataatcaatatggtgctgctaacagcttcaattatgctgct
gtctcaaggccactggctacctcaggtttcttttacccaacctggccgagctcgctgaat
ggaccagttttgaatagccatggatcagagactgattgcatggatgattcctctaattca
ggcaccctttcaaactctgggggatctagaagctccaccccacatcaccagcagtcctct
cagcgctcacctgctcactacccaatgtctgatagtccccatgggtttctagatccaagt
aagacctctggtgatggagacttttatgccagcgatgcagaagtagaggccaagaggcga
atcatttttactataactagtggtggaagctcctcagggaggtcaccatcaaataaacat
agtccattaacagcaactattcgcatggagagtggcccgggacaggatggcagaaggaaa
ggtagccgacgcaagaggccctatgctggaaactacagcctggtagtgtctcctaagcgt
agatcacttccatcatcttttggactgaacggctatacttcaggatctccaatgagtatc
aactcaatggtaaataacattaatcagcctttggaaatcactgctatttcatctcccgaa
aactcactgaaaagttccccagcaccataccaggatcatgaattacccccagtcttaaaa
aaggagaaacctttaccctcaactaatggggttcattactcgcctctcacaacagaggat
gagatggaatctgatgaggagttccccaatgcaag

DBGET integrated database retrieval system