KEGG   Nanorana parkeri: 108802996
Entry
108802996         CDS       T04897                                 

Definition
(RefSeq) protransforming growth factor alpha-like
  KO
K08774  transforming growth factor, alpha
Organism
npr  Nanorana parkeri
Pathway
npr04010  MAPK signaling pathway
npr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:npr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108802996
   04012 ErbB signaling pathway
    108802996
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 108802996
NCBI-ProteinID: XP_018430352
LinkDB
Position
Unknown
AA seq 215 aa
MACGAICDRSHLLPLSAFFSHFFPGRSTPTSLPGNGAIPAWAGCVGLVEAAPSSALKRKE
QASFLYFGGSIKRKISTMFLGFLLVTGISVSLAHNSSTEAGNSSYFTETATRTLFAQCPD
TYSSFCYHGTCRFLLSELEASCVCFKGYIGIRCEHVDLLQVMAAAPPSFLVVALSVTFLA
ILTLIGSTCLVIYFCRVRRERNRQTLLKNIEQNDV
NT seq 648 nt   +upstreamnt  +downstreamnt
atggcgtgtggagcgatctgtgaccgcagtcacctcctccccttgtctgccttcttttca
cacttcttcccggggagatcgacgccaacgtcgttacctggcaacggcgcaatcccggcc
tgggcaggctgtgtcggcttagtggaggcagcgccatctagtgcactaaagaggaaagag
caggcgagctttttatattttggaggatccatcaaaagaaaaatatccacaatgttcctt
ggattcctcctagttacaggtatttcagtcagtttggctcacaactccagcactgaagca
gggaactcctcctactttactgagacagcaacaagaacattattcgctcaatgtccagac
acatactccagcttctgctaccatggcacatgcagattccttctatctgaattggaggcc
tcttgtgtatgctttaaaggctatattggtattcgctgtgaacatgtggacctgttgcag
gtgatggctgctgctcctccttccttcctggtggtggcactgtcggtgacctttctggct
atattaactctaataggtagcacatgccttgtgatatacttctgcagagtaagaagagag
agaaacaggcaaacccttctgaagaatatagaacagaatgatgtctga

DBGET integrated database retrieval system