KEGG   Novosphingobium tardaugens: EGO55_11865Help
Entry
EGO55_11865       CDS       T05741                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ntd  Novosphingobium tardaugens
Brite
KEGG Orthology (KO) [BR:ntd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EGO55_11865 (ahpF)
Enzymes [BR:ntd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EGO55_11865 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like K_oxygenase AlaDh_PNT_C FAD_binding_3 Spermine_synth DAO Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AZI36564
UniProt: U2ZUZ8
LinkDB All DBs
Position
complement(2536202..2537794)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKQQLQQYLGMLREPIELVASLGDDVKSQETRELLTTIAGLSDKVTASFDGANAR
KPSFQIRRASDHAAGVTFAGLPLGHEFTSLVLALLWTGGHPPKVEQDVIDQIKALDGDFD
FEMYFSLSCHNCPDVVQALALMAINNPRISATLIEGGAFKDEVEDRKVMAVPAVFLGGEP
FANGRMEIGEILAKLDSNAGAKAAEKIAGKEPFEVLIVGGGPAGAAASIYTARKGFRTGI
AAERFGGQVLDTMGIENFISIPYTEGPKLAAQLEQHVAEYDIDVMNLQLAEKLIPASQVG
GLHEVVLANGASLKARALILTTGARWRNLGVPGEFEYRTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLANIVGHVTLVEFDPQLRADQVLQDKLRSMANVDIIVSAQTTEVLGD
GEQVTGLAYKDRSDGTEHTIDLQGVFVQIGLVPNTEWLQDSGIELTTRGEIVIDDRAATS
IPGVFAAGDVTTVPYKQIIIAMGEGAKASLSAFDYLIRTQPAEEKVPEPA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatgccaatctgaagcaacagctccagcaatatctcggcatgctgcgcgagccg
atcgagctcgtcgcctctctcggcgacgacgtcaaatcgcaagaaacgcgtgagctgctg
accacaatcgccggcctgtccgacaaggtcaccgccagcttcgacggcgccaacgcgcgc
aaacccagtttccagatccgccgggcgagcgaccatgccgccggggtgacctttgccggg
ctgccactgggccacgaattcacctcgctggtgcttgcgctcctgtggacgggcggccat
ccgccgaaagtcgaacaggacgtgatcgatcagatcaaggcgctcgacggcgatttcgat
ttcgaaatgtatttctcgctgtcgtgccacaactgccccgatgtggtgcaggcgctggcg
ctgatggcgatcaacaacccgcgtatttcggccacgctgatcgaaggcggcgctttcaag
gacgaagtcgaagaccgcaaggtcatggcggtccctgccgtgttcctgggcggcgaaccc
ttcgccaatgggcgcatggaaatcggcgagattctggccaagctcgacagcaatgccggc
gcgaaagcggcggaaaagattgcgggcaaggaaccgttcgaagtgctgatcgtgggcggt
ggcccggctggcgccgcggcatcgatctacaccgcccgcaagggattccgcaccggtatc
gcggcggaacgctttggcgggcaggtgctcgacaccatgggtatcgagaacttcatttcg
attccctataccgaagggcccaagctggctgcccagttggaacagcacgtcgcggaatac
gatatcgacgtgatgaacctgcagcttgccgaaaaactcatcccggcgagccaggtcggc
gggttgcatgaagtggttctggccaatggcgcctcgctcaaggcccgcgcgctcattctc
accaccggtgcccggtggcgcaatctgggtgtgcccggcgaattcgagtaccggacgcgc
ggagtggcctattgcccgcactgcgatggccccctgttcaagggcaagcgcgtggcggtg
atcggcggcggcaactccggcgtggaagcggcgatcgatcttgccaacatcgtcggtcac
gtcactctggtcgaattcgatccgcagttgcgcgccgatcaggtgctgcaggacaagctg
cgttcgatggccaatgtcgacatcatcgtttcggcacaaaccaccgaagtgctgggcgat
ggcgaacaggtcaccggccttgcctacaaggaccggagcgatggcaccgaacacacgatc
gatctgcagggcgtgttcgtccagatcgggctcgtacccaataccgaatggttgcaggat
tcgggcatcgaactgaccacacggggtgaaatcgtgatcgacgatcgcgccgccacctcc
atccccggcgtcttcgctgcgggcgatgtgaccacagtgccttacaagcagatcatcatc
gccatgggcgaaggggccaaggcgtcgctgtccgccttcgattacctgatccgcacgcag
cctgccgaggaaaaggtccccgaaccggcctga

DBGET integrated database retrieval system