KEGG   Neokomagataea tanensis: D5366_05400Help
Entry
D5366_05400       CDS       T06079                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ntn  Neokomagataea tanensis
Brite
KEGG Orthology (KO) [BR:ntn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D5366_05400 (ahpF)
Enzymes [BR:ntn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D5366_05400 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored FAD_binding_2 HI0933_like Thi4 DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: QDH24756
UniProt: A0A4Y6V876
LinkDB All DBs
Position
1156559..1158115
Genome map
AA seq 518 aa AA seqDB search
MLQDDLKTQMRAYMDYLRENVVLEATLGADDRSNEIRGVLEEVASLSDKVSFSDQGTASR
SPSFLIRRAGSNEQVSFGGLPMGHEFTSFVLALLQVGGHPPKVDADQIEQIRALDGEFRF
ETYFSQSCQNCPDVVQALNTLSVLNPKIQHIAIDGADFQAEVEERGIRSVPQIYLNGVPF
SSGRMDINQILAKLDESSVERAAAKLDDLAPFDVLVLGGGPAGASAAVYAARKGLRTGLV
AERFGGQVMDTAGIENFISVKETEGPHLAAAFEAHVRQYDVEVITSQRATKLVPKQGETG
LHEIALESGASLRSKTIILATGARWRQLGVPGEKEYMTKGVAYCPHCDGPFYKGRPVVVA
GGGNSGVEAAIDLAGIVSHVTLLQRGGQLKADKVLQDKLHSLKNVTVLTNALTSEIQGNG
KEVTGLTYQGADGAAHELKVDGVFVQIGLLPNTEWLQGALDLSPYGEIVVNDHCATSVPG
VFAAGDATTVPYKQIVIATGEGAKASLSAFDYLIRLPV
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaggacgacctgaaaacccagatgcgcgcctacatggactatctgcgcgagaac
gtcgttcttgaagcgacgctgggagcagatgaccgctcgaacgaaattcgtggcgtgttg
gaagaagtcgccagcctgtccgacaaggtaagtttttcggatcagggcacggcctcgcgt
agcccatcattccttatccgccgtgcgggttcgaatgagcaggtctctttcggcggtctg
ccgatgggtcatgaattcacgtcgtttgtgctggcgctcctgcaggtgggtggtcacccc
ccgaaagttgatgcggaccaaatcgaacaaattcgcgcgttggatggtgagttccgtttt
gagacgtacttctcccagtcatgccaaaactgccctgacgttgtacaggctctcaacacc
ttaagtgtccttaacccaaaaattcagcatatcgccattgatggtgcagattttcaggct
gaggtcgaagagcgcggcatccgttccgtaccgcagatttacctcaatggtgtgccattc
tcatcagggcgcatggacataaaccagatactggccaagctggatgagtcttcggttgag
cgcgctgcggccaagttggatgatcttgctccgtttgacgttctggttctgggtggtgga
ccggctggcgcctctgccgctgtttatgccgcgcgtaaggggttgcggacagggctggta
gctgagcgttttggcggccaagttatggatacggctggcatcgaaaacttcatttccgtc
aaggaaacagaaggcccgcatctcgccgctgcgtttgaggcccatgtacgccaatatgac
gtagaggttatcacgtcgcagcgcgcaaccaagcttgtgccaaagcaaggcgaaacaggt
ttgcatgagattgctctcgaaagtggtgcaagcctgcgctccaagacgatcatcctcgcg
acgggtgcgcgctggcgtcagttaggtgtgccgggtgagaaggaatacatgaccaagggc
gtggcatactgcccgcattgtgatggtccgttctacaaggggcgtccagtcgttgttgct
ggtggtggcaatagtggcgtagaagctgcgattgatttggcgggtatcgtttctcacgtt
acgcttttgcagcgtggtggccaacttaaggctgataaggttctgcaagataagctgcac
agcctgaagaacgtaactgtgttgacgaacgcccttacctccgaaattcagggtaacggt
aaggaagtcacgggcctcacataccaaggtgctgatggtgctgcgcacgaactgaaggtc
gatggcgtgtttgtacaaatcggtctgttgccaaacacagaatggcttcaaggggcgctg
gatctgtccccttatggcgagattgttgtcaacgaccattgcgcaacatcagtcccaggt
gtttttgcagcgggcgatgcgactacggtaccgtacaagcagatcgttatagcgaccggt
gagggtgcaaaagcgtccctgtcagcctttgattatctgatacgtctgcctgtttga

DBGET integrated database retrieval system