KEGG   Ornithorhynchus anatinus (platypus): 100078561Help
Entry
100078561         CDS       T01045                                 

Gene name
AMY2A
Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00500  Starch and sucrose metabolism
oaa01100  Metabolic pathways
oaa04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100078561 (AMY2A)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100078561 (AMY2A)
Enzymes [BR:oaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     100078561 (AMY2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 100078561
NCBI-ProteinID: XP_001510273
UniProt: F6QRX2
LinkDB All DBs
Position
Un
AA seq 510 aa AA seqDB search
MKLFLLLAVVGLGWAQYDPHTKPGKTSIVHLFEWRWDDIALECERYLAPNGFGGVQISPP
SENVVINNPSRPWWERYQPISYKICTRSGNEDEFRAMVTRCNNVGVHIYVDAVINHMCGA
NIGQGSSTCGSFFNSATREFSEVPYSGWDFNDGKCKTHSGDIENYNDPYQVRDCRLVSLL
DLALEKDYVRSRVAKYMNKLIDIGVAGFRIDASKHMWPGDMKAILDKLHNLNTHWFPAGA
KPFVYQEVIDLGGEPITSSEYFGTGRVTEFKYGAKLGTVLRKWNGEKMAYLRNWGEGWGF
MPSDKALVFVDNHDNQRGHGAGGASILTFWDSRLYKMGVGFMLAHPYGFTRVMSSFSWPR
KFENGKDINEWVGPPNDNGVIKEVTINEDTTCGNGWVCEHRWRQIRNMVIFRNVVDGQPF
TNWWDNLSNQVAFGRGNKGFIVFNNDDWPLSEYLQTGLPAGTYCDVISGDKRDDHCTGIK
VYVSKDGKAQFSISNTAEDPFIAIHAESKL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttctattgcttgcagtggttgggctaggctgggctcagtatgaccctcac
accaaacccggcaaaacatctattgtccacttgttcgaatggcgctgggatgatattgct
cttgaatgtgaacgttacttagcacccaatggatttgggggagtccagatttctcctccc
agtgaaaatgtggtgatcaataacccctcaagaccttggtgggaaagataccagccaatt
agctacaaaatttgtacccgatctggaaatgaagatgaattcagagccatggtgaccaga
tgtaacaatgttggcgtgcatatttatgtggatgctgtcatcaatcacatgtgtggagcc
aatattggtcagggatcaagtacctgtggaagctttttcaattcagccaccagggaattt
tctgaagttccttattcaggttgggactttaatgatggcaaatgcaaaactcatagtgga
gatattgaaaactacaatgacccttatcaggttagagactgtcgtctagtcagtcttctt
gaccttgccctggaaaaagattatgttcgttccagagttgccaaatacatgaacaagctg
attgacataggtgtggctggattcagaattgatgcttccaaacatatgtggcctggtgac
atgaaggcaattttggataaactgcataatctaaatacacactggttcccagcaggagca
aaaccttttgtctaccaggaggtaattgacctagggggcgaacccattacgagtagtgag
tattttggaactggtcgggtgacagaattcaaatatggtgccaaacttggcacggttctg
cgcaagtggaatggagagaagatggcttatttgaggaactggggagaaggctggggtttc
atgccttctgacaaagccctcgtgtttgtggataaccatgacaatcagaggggacatgga
gctggtggggcttctatcctcacattctgggattccagactctacaaaatgggagttggg
tttatgcttgctcatccatatggatttacccgagtcatgtctagcttcagctggccaaga
aaatttgagaacgggaaggatattaacgaatgggttggaccacctaatgataatggagtt
atcaaagaagttaccatcaacgaagacactacctgtggcaacggttgggtctgtgagcat
aggtggcgacagataaggaacatggtgattttccgtaatgttgtcgatggccaacctttc
acaaactggtgggataatctgagcaaccaagtggcctttggacgtgggaataagggattc
attgtcttcaacaacgatgactggccattatctgaatacctgcaaactggtcttcctgct
gggacatactgtgatgtcatttctggtgacaaacgagatgaccactgtacgggaattaaa
gtctatgtgtccaaagatggcaaggctcagttcagtattagtaacacagctgaagatcca
ttcattgcaattcatgcagaatccaaattgtaa

DBGET integrated database retrieval system