KEGG   Ornithorhynchus anatinus (platypus): 100081645
Entry
100081645         CDS       T01045                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oaa  Ornithorhynchus anatinus (platypus)
Pathway
oaa00480  Glutathione metabolism
oaa00980  Metabolism of xenobiotics by cytochrome P450
oaa00982  Drug metabolism - cytochrome P450
oaa00983  Drug metabolism - other enzymes
oaa01100  Metabolic pathways
oaa01524  Platinum drug resistance
oaa05200  Pathways in cancer
oaa05204  Chemical carcinogenesis
oaa05225  Hepatocellular carcinoma
oaa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oaa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100081645 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100081645 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    100081645 (GSTO1)
   00983 Drug metabolism - other enzymes
    100081645 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100081645 (GSTO1)
   05204 Chemical carcinogenesis
    100081645 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100081645 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100081645 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100081645 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oaa02000]
    100081645 (GSTO1)
Enzymes [BR:oaa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     100081645 (GSTO1)
Transporters [BR:oaa02000]
 Other transporters
  Pores ion channels [TC:1]
   100081645 (GSTO1)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Other DBs
NCBI-GeneID: 100081645
NCBI-ProteinID: XP_001512410
LinkDB
Position
16
AA seq 245 aa
MSGLSGVSSKSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLNAKGIKHEVVNINLK
NKPEWFFQKHPLGQVPVLETSKGQLIYESSITCEYLDEAYPEKKLFPDDPYEKAYQKMIF
NQFSKVPPLALKCMTGARNGEDCSDLKAELRKEFSMLEEILSRRKTQYFSGDSITMIDYL
LWTWFERLELFKIADCVDHTPNLKLWIAAMTENPFVKAIFTDLKTSQGFMELYLNNSPEA
CDYGL
NT seq 738 nt   +upstreamnt  +downstreamnt
atgtcgggactgtcgggggtgtcgtccaagagcctgggaaagggcagcgccccgccaggc
ccggtccccgagggcctgatccgagtgtacagcatgaggttttgcccctacgccaagcgg
accctgctggtcctcaacgccaaaggaatcaaacacgaagttgtcaacatcaacttgaag
aataagcctgaatggttctttcagaagcacccccttggccaggtgccagttctggagacc
agcaagggtcagctgatctatgaatcttccatcacctgcgagtacctggatgaagcctac
cctgagaagaaactgttcccagatgacccttatgaaaaggcgtaccaaaagatgatcttt
aaccagttctctaaggtaccacctttggctttgaaatgtatgaccggagcccggaatggg
gaagattgctctgacctgaaggcagaactgcgtaaggaattcagcatgttggaggagatt
ctttcccgccgcaagacacaatattttagcggagactcaataaccatgattgattacctg
ctgtggacgtggtttgagcggctggaactcttcaagatcgccgactgtgtggatcacacc
ccgaatctcaagctctggatcgcagccatgacagagaatccatttgtcaaggctattttc
actgacctgaaaacttcccaaggcttcatggagctgtatctcaataacagccctgaggcc
tgtgactatgggctgtga

DBGET integrated database retrieval system