Ornithorhynchus anatinus (platypus): 100087807 Help Entry 100087807         CDS       T01045                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04015   Rap1 signaling pathway oaa04810   Regulation of actin cytoskeleton oaa05014   Amyotrophic lateral sclerosis oaa05132   Salmonella infection Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100087807 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100087807 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100087807 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100087807 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oaa04131]     100087807 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oaa04812]     100087807 (PFN3)    04147 Exosome [BR:oaa04147]     100087807 (PFN3) Membrane trafficking [BR:oaa04131]  Others   Actin-binding proteins    Others     100087807 (PFN3) Cytoskeleton proteins [BR:oaa04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100087807 (PFN3) Exosome [BR:oaa04147]  Exosomal proteins   Proteins found in most exosomes    100087807 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100087807 NCBI-ProteinID:  XP_001517647 Ensembl:  ENSOANG00000048321 UniProt:  A0A6I8NLV1 LinkDB All DBs Position X2:4447176..4447800 Genome browser AA seq 137 aa AA seqDB search MRDWRILVEAVLRPGRVEDVAVVGHSANRCVWASRPGGLLAAISPQEVGVLTGPDRRSFL LAGFRLAGRRCYVIRDHLLLDGDGVLDGRTAGPEGRAVCVGRTPKVLVVLLGRRGVHGGL LNKTAHSLIRLLKSQGT NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgcgcgactggcggatcctggtggaggccgtgctgcggcccgggcgcgtcgaggacgtg gccgtggtggggcactccgccaaccgctgcgtctgggcctcccggcccggggggctgctg gccgccatctccccgcaggaggtgggcgtgctgaccgggccggaccgccggtccttcctg ctggcgggcttccgcctggccggccgccgctgctatgtcatccgagaccacctgctgctg gacggcgacggggtcctggacggccggacggcggggccggaggggcgggccgtgtgcgtg ggccgcacccccaaggtcctggtcgtgctgctgggccggaggggcgtccacggcgggttg ctcaacaagaccgcccacagcctcatccggctcctcaaatcccaaggcacctag

DBGET integrated database retrieval system