Ornithorhynchus anatinus (platypus): 100090494 Help Entry 100090494         CDS       T01045                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism oaa  Ornithorhynchus anatinus (platypus) Pathway oaa04010   MAPK signaling pathway oaa04014   Ras signaling pathway oaa04024   cAMP signaling pathway oaa04072   Phospholipase D signaling pathway oaa04137   Mitophagy - animal oaa04140   Autophagy - animal oaa04218   Cellular senescence oaa04371   Apelin signaling pathway oaa04625   C-type lectin receptor signaling pathway oaa04810   Regulation of actin cytoskeleton oaa05205   Proteoglycans in cancer Brite KEGG Orthology (KO) [BR:oaa00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100090494 (RRAS2)    04014 Ras signaling pathway     100090494 (RRAS2)    04371 Apelin signaling pathway     100090494 (RRAS2)    04072 Phospholipase D signaling pathway     100090494 (RRAS2)    04024 cAMP signaling pathway     100090494 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100090494 (RRAS2)    04137 Mitophagy - animal     100090494 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     100090494 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100090494 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100090494 (RRAS2)  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100090494 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oaa04147]     100090494 (RRAS2)    04031 GTP-binding proteins [BR:oaa04031]     100090494 (RRAS2) Exosome [BR:oaa04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100090494 (RRAS2)   Exosomal proteins of bladder cancer cells    100090494 (RRAS2) GTP-binding proteins [BR:oaa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100090494 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 SLFN-g3_helicase Motif Other DBs NCBI-GeneID:  100090494 NCBI-ProteinID:  XP_039767592 Ensembl:  ENSOANG00000012470 LinkDB All DBs Position 3:11532686..11626103 Genome browser AA seq 211 aa AA seqDB search MAAGSSSGWGCRERAGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTK QCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILR VKDRDEFPMILVGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVR VIRKFQEQECPPSPEPARKEKDKKGCHCVIF NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcggcggggtcgtcgtcggggtgggggtgccgggagcgggccggctccggccaggag aagtaccgactcgtcgtcgtcgggggcggcggcgtcggaaagtcggcgctcaccatccag ttcatccagtcctattttgtcacagattatgatcccacaattgaagattcttataccaaa cagtgtgtgatagacgacagagctgctcggctagatattctggatacagcaggacaagaa gaatttggggctatgagagaacagtacatgaggactggagaaggtttccttttggtcttc tcagtcactgaccgaggaagttttgaagaaatatataagtttcaaagacagattctcaga gtgaaggatcgtgatgagtttccaatgattctagttggtaacaaagcagatcttgaccat caaagacaggtaacacaggaagagggacaacaactagcgcgacaactaaaagtcacatat atggaagcgtcagccaaaattagaatgaatgtagaccaagctttccatgagctcgtcagg gttataagaaaatttcaagagcaagaatgtcctccttcgccagaaccagcacggaaagaa aaagacaagaaaggctgccattgtgtcattttctaa

DBGET integrated database retrieval system