KEGG   Ochrobactrum anthropi OAB: DR92_1231Help
Entry
DR92_1231         CDS       T03251                                 

Definition
(GenBank) D-alanine--D-alanine ligase family protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00473  D-Alanine metabolism
oah00550  Peptidoglycan biosynthesis
oah01100  Metabolic pathways
oah01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    DR92_1231
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DR92_1231
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    DR92_1231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:oah01011]
    DR92_1231
Enzymes [BR:oah01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     DR92_1231
Peptidoglycan biosynthesis and degradation proteins [BR:oah01011]
 Precursor biosynthesis
  Amino acid ligase
   DR92_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AIK45128
UniProt: A0A427JJ36
LinkDB All DBs
Position
1:1294976..1295902
Genome map
AA seq 308 aa AA seqDB search
MTGKHVAVLMGGFSSERPVSLSSGTACAATLEERGYCVTRIDVDRNVASVLAELKPDVAF
NALHGPFGEDGAIQGVLEYLQIPYTHSGVLASALAMDKDRAKKVAAAAGVAVASSLLLNR
FEIGTEHPMEPPYVVKPVREGSSFGVVIVKEDQTHPPQIISSAEWNYGAEVLVEKYIPGR
ELTCAVMGDRVMDVCEIIPVGHQFYDYDSKYVAGASSHVCPAKILPNIYQKIQTMALTAH
RAIGCRGVSRSDFRFDDRFSDDGEVIWLEINTQPGMTPTSLVPDIAKAAGISFGELLSWM
VEDASCLR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacgggaaagcacgtcgccgttttgatgggcggtttctcttcggagcgcccggtcagc
ttgtcctccggaacggcttgcgctgcgacccttgaagagcgcggctattgcgtgacgcgt
attgatgtggatcgcaatgttgccagcgttcttgccgaactgaagcccgacgttgcgttc
aatgcgctgcatggccctttcggtgaggatggcgctattcagggcgttctcgaatatctc
cagattccctacacgcattcgggtgtgctcgcatcggcgctcgccatggacaaggaccgc
gccaagaaggttgcggctgctgccggtgttgctgttgcttcctcgcttctgctcaaccgt
tttgagatcggcactgagcatccgatggagccgccttacgtggtcaagcctgttcgcgaa
ggttcgagctttggcgtcgtgatcgtcaaggaggatcagacgcatccgccgcaaatcatc
agttcggctgagtggaactacggtgccgaggttctggtcgaaaaatacattcccggccgg
gaattgacctgtgccgtgatgggtgaccgcgtcatggacgtgtgtgagatcattccggtc
ggtcatcagttctacgattatgattcaaaatatgttgcaggcgcgtcatctcacgtgtgt
ccggcaaaaattttaccaaatatttaccaaaaaatacaaacaatggcccttacggcgcat
cgggcaatcgggtgtcggggcgtaagccggtcagacttccgtttcgacgatcgtttctct
gatgatggcgaagttatctggctggaaatcaatacccagccggggatgactcctacctcg
ctcgtgcctgatatcgccaaagcggctggtatctctttcggtgaattgttgagttggatg
gtggaggacgcgtcttgtttgcgttga

DBGET integrated database retrieval system