KEGG   Ochrobactrum anthropi OAB: DR92_37Help
Entry
DR92_37           CDS       T03251                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
oah  Ochrobactrum anthropi OAB
Pathway
oah00010  Glycolysis / Gluconeogenesis
oah00620  Pyruvate metabolism
oah01100  Metabolic pathways
oah01110  Biosynthesis of secondary metabolites
oah01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oah00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DR92_37 (acoD)
   00620 Pyruvate metabolism
    DR92_37 (acoD)
Enzymes [BR:oah01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     DR92_37 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AIK44526
LinkDB All DBs
Position
1:complement(43355..44872)
Genome map
AA seq 505 aa AA seqDB search
MNKVEFSRTVKPAFAKRYGNFIGGKWVEPKSGRYFENTSPVNGQVLCEVARSDAADVEAA
LDAAHAAKDAWGKTSAAERALILNRIADRIEENLPALAAAETWDNGKPIRETTAADLPLA
IDHFRYFAGVIRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPLLMATWKLAPALAA
GNCVVLKPAEQTPASILVLMDLIGDLLPPGVINVVNGFGLEAGKPLASSPRIAKIAFTGE
TTTGRLIMQYASQNLIPVTLELGGKSPNIFFKDVAAEDDDFLDKAIEGFVMFALNQGEVC
TCPSRALIHESIYDKFMEKALKRVNAIVQGDPLDPATMIGAQASSEQLEKILSYLDIGRQ
EGAEVLAGGERNILPGDLAGGYYVKPTVFKGTNKMRVFQEEIFGPVVSVATFKDDAEALS
IANDTLYGLGAGIWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRENH
LKMLDHYQNTKNMLVSYSPKKLGFF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaggttgaattcagccggaccgtgaagccggctttcgcaaaacgctacggaaac
ttcatcgggggcaaatgggtcgagcccaagtcgggccgctatttcgagaacacttcaccg
gtcaatggtcaggtgctttgcgaagtagcccgctcggatgccgctgatgtcgaagcggct
cttgatgcagcgcatgccgccaaggatgcctggggcaagacgagcgcggctgaacgcgcg
ctcatcctcaatcgcattgctgaccggattgaggaaaacctgcctgcgctcgctgccgcc
gaaacctgggacaacggcaagccaatccgcgaaactaccgctgccgatcttcctctggcc
atcgaccatttccgctatttcgccggtgtgatccgcgcccaggaaggcagcatttccgaa
atcgaccacgacacggtcgcttatcatttccatgaaccactcggtgttgtcgggcagatc
attccgtggaacttcccgcttctcatggcgacatggaagctcgctccggcccttgcggcg
ggcaactgcgtcgtcctgaaaccggctgaacagacaccggcatcgatcctcgtgctcatg
gatctgatcggcgatcttttgccccccggtgtgatcaatgtcgtcaatggttttggtctt
gaggcaggcaaaccgctcgcgtcgagcccgcgcatcgccaagatcgccttcaccggcgaa
acgacgacgggtcgattgatcatgcaatatgccagccagaaccttatcccggttacactg
gaactcggcggcaagtcgccgaacatcttcttcaaggatgtcgcagcggaagacgacgat
ttcctcgacaaggccatcgaaggctttgtgatgttcgcactcaatcagggcgaagtctgc
acgtgcccaagtcgcgcgctcatccatgaatcgatttacgacaagttcatggaaaaggcg
ctcaagcgcgtgaatgcaatcgtgcagggcgatcccctcgatcctgccacgatgatcggt
gcacaggcttccagtgagcagctggaaaaaatcctgagctatctcgatattggccgccaa
gaaggtgctgaagtgctggcaggtggcgagcgcaatattctgccgggcgatctggctggc
ggttattacgtcaagccgaccgtattcaagggcaccaacaagatgcgtgttttccaggag
gaaatcttcgggccggtcgtgtctgttgctaccttcaaggacgatgcggaggcgctatcg
attgccaacgatacgctttacggtctgggcgccggtatatggacgcgtgatggcacgcgt
gcctatcgcttcgggcgtgccattcaggccggtcgtgtgtggaccaattgctatcatgcc
tatccggcgcatgcggcattcggcggttacaagcaatcgggtatcggtcgcgaaaaccat
ctgaaaatgctggaccactatcagaacaccaagaatatgctggtgagctacagcccgaag
aagctgggtttcttctaa

DBGET integrated database retrieval system