KEGG   Ovis aries (sheep): 100169938
Entry
100169938         CDS       T03117                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04012  ErbB signaling pathway
oas04062  Chemokine signaling pathway
oas04110  Cell cycle
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04310  Wnt signaling pathway
oas04340  Hedgehog signaling pathway
oas04360  Axon guidance
oas04390  Hippo signaling pathway
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04657  IL-17 signaling pathway
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04722  Neurotrophin signaling pathway
oas04728  Dopaminergic synapse
oas04910  Insulin signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05135  Yersinia infection
oas05160  Hepatitis C
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05217  Basal cell carcinoma
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100169938 (GSK3B)
   04310 Wnt signaling pathway
    100169938 (GSK3B)
   04340 Hedgehog signaling pathway
    100169938 (GSK3B)
   04390 Hippo signaling pathway
    100169938 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100169938 (GSK3B)
   04150 mTOR signaling pathway
    100169938 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100169938 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100169938 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100169938 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100169938 (GSK3B)
   04657 IL-17 signaling pathway
    100169938 (GSK3B)
   04662 B cell receptor signaling pathway
    100169938 (GSK3B)
   04062 Chemokine signaling pathway
    100169938 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100169938 (GSK3B)
   04917 Prolactin signaling pathway
    100169938 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100169938 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100169938 (GSK3B)
   04916 Melanogenesis
    100169938 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100169938 (GSK3B)
   04722 Neurotrophin signaling pathway
    100169938 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100169938 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100169938 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100169938 (GSK3B)
   05225 Hepatocellular carcinoma
    100169938 (GSK3B)
   05226 Gastric cancer
    100169938 (GSK3B)
   05217 Basal cell carcinoma
    100169938 (GSK3B)
   05215 Prostate cancer
    100169938 (GSK3B)
   05213 Endometrial cancer
    100169938 (GSK3B)
   05224 Breast cancer
    100169938 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100169938 (GSK3B)
   05020 Prion disease
    100169938 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100169938 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100169938 (GSK3B)
   04931 Insulin resistance
    100169938 (GSK3B)
   04934 Cushing syndrome
    100169938 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100169938 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100169938 (GSK3B)
   05162 Measles
    100169938 (GSK3B)
   05163 Human cytomegalovirus infection
    100169938 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100169938 (GSK3B)
   05165 Human papillomavirus infection
    100169938 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100169938 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    100169938 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    100169938 (GSK3B)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100169938 (GSK3B)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100169938 (GSK3B)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100169938 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100169938
NCBI-ProteinID: NP_001123212
Ensembl: ENSOARG00000019835
UniProt: B3FL75 A0A6P9FQG8
LinkDB
Position
1
AA seq 420 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQTNNAASASASDSS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaagatggcagcaaggtaaccacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtgtatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gaaaagaaagatgaggtctatcttaatctggtgctggactacgttccggaaacagtctac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttgaaactctgtgac
tttggaagtgcaaagcagctggtccgtggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttgctaggacagccaatatttccaggagac
agtggtgtggatcaattggtggaaataatcaaggtcctgggaacaccaacaagggagcaa
attagagaaatgaacccaaactacacggaattcaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccacccgaggcgattgcactttgtagccgtctg
ctggagtatacaccaactgcccgactgacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctagctaccatccttattcctcct
catgctcggattcaagcagctgcttcaactccttcaaataccacagcagcctcagatgct
aatgctggagaccgtggacagaccaataatgccgcttctgcatcagcttccgactcctcc
tga

DBGET integrated database retrieval system