Ovis aries (sheep): 100169938 Help Entry 100169938         CDS       T03117                                  Gene name GSK3B Definition (RefSeq) glycogen synthase kinase-3 beta   KO K03083   glycogen synthase kinase 3 beta [EC:2.7.11.26] Organism oas  Ovis aries (sheep) Pathway oas01521   EGFR tyrosine kinase inhibitor resistance oas04012   ErbB signaling pathway oas04062   Chemokine signaling pathway oas04110   Cell cycle oas04150   mTOR signaling pathway oas04151   PI3K-Akt signaling pathway oas04310   Wnt signaling pathway oas04340   Hedgehog signaling pathway oas04360   Axon guidance oas04390   Hippo signaling pathway oas04510   Focal adhesion oas04550   Signaling pathways regulating pluripotency of stem cells oas04657   IL-17 signaling pathway oas04660   T cell receptor signaling pathway oas04662   B cell receptor signaling pathway oas04722   Neurotrophin signaling pathway oas04728   Dopaminergic synapse oas04910   Insulin signaling pathway oas04916   Melanogenesis oas04917   Prolactin signaling pathway oas04919   Thyroid hormone signaling pathway oas04931   Insulin resistance oas04932   Non-alcoholic fatty liver disease oas04934   Cushing syndrome oas04935   Growth hormone synthesis, secretion and action oas05010   Alzheimer disease oas05020   Prion disease oas05022   Pathways of neurodegeneration - multiple diseases oas05135   Yersinia infection oas05160   Hepatitis C oas05162   Measles oas05163   Human cytomegalovirus infection oas05165   Human papillomavirus infection oas05167   Kaposi sarcoma-associated herpesvirus infection oas05200   Pathways in cancer oas05210   Colorectal cancer oas05213   Endometrial cancer oas05215   Prostate cancer oas05217   Basal cell carcinoma oas05224   Breast cancer oas05225   Hepatocellular carcinoma oas05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oas00001]  09130 Environmental Information Processing   09132 Signal transduction    04012 ErbB signaling pathway     100169938 (GSK3B)    04310 Wnt signaling pathway     100169938 (GSK3B)    04340 Hedgehog signaling pathway     100169938 (GSK3B)    04390 Hippo signaling pathway     100169938 (GSK3B)    04151 PI3K-Akt signaling pathway     100169938 (GSK3B)    04150 mTOR signaling pathway     100169938 (GSK3B)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100169938 (GSK3B)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100169938 (GSK3B)    04550 Signaling pathways regulating pluripotency of stem cells     100169938 (GSK3B)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100169938 (GSK3B)    04657 IL-17 signaling pathway     100169938 (GSK3B)    04662 B cell receptor signaling pathway     100169938 (GSK3B)    04062 Chemokine signaling pathway     100169938 (GSK3B)   09152 Endocrine system    04910 Insulin signaling pathway     100169938 (GSK3B)    04917 Prolactin signaling pathway     100169938 (GSK3B)    04935 Growth hormone synthesis, secretion and action     100169938 (GSK3B)    04919 Thyroid hormone signaling pathway     100169938 (GSK3B)    04916 Melanogenesis     100169938 (GSK3B)   09156 Nervous system    04728 Dopaminergic synapse     100169938 (GSK3B)    04722 Neurotrophin signaling pathway     100169938 (GSK3B)   09158 Development and regeneration    04360 Axon guidance     100169938 (GSK3B)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100169938 (GSK3B)   09162 Cancer: specific types    05210 Colorectal cancer     100169938 (GSK3B)    05225 Hepatocellular carcinoma     100169938 (GSK3B)    05226 Gastric cancer     100169938 (GSK3B)    05217 Basal cell carcinoma     100169938 (GSK3B)    05215 Prostate cancer     100169938 (GSK3B)    05213 Endometrial cancer     100169938 (GSK3B)    05224 Breast cancer     100169938 (GSK3B)   09164 Neurodegenerative disease    05010 Alzheimer disease     100169938 (GSK3B)    05020 Prion disease     100169938 (GSK3B)    05022 Pathways of neurodegeneration - multiple diseases     100169938 (GSK3B)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100169938 (GSK3B)    04931 Insulin resistance     100169938 (GSK3B)    04934 Cushing syndrome     100169938 (GSK3B)   09171 Infectious disease: bacterial    05135 Yersinia infection     100169938 (GSK3B)   09172 Infectious disease: viral    05160 Hepatitis C     100169938 (GSK3B)    05162 Measles     100169938 (GSK3B)    05163 Human cytomegalovirus infection     100169938 (GSK3B)    05167 Kaposi sarcoma-associated herpesvirus infection     100169938 (GSK3B)    05165 Human papillomavirus infection     100169938 (GSK3B)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100169938 (GSK3B)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:oas01001]     100169938 (GSK3B)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oas03036]     100169938 (GSK3B) Enzymes [BR:oas01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.26  tau-protein kinase      100169938 (GSK3B) Protein kinases [BR:oas01001]  Serine/threonine kinases: CMGC group   GSK family [OT]    100169938 (GSK3B) Chromosome and associated proteins [BR:oas03036]  Eukaryotic type   Centrosome formation and ciliogenesis proteins    Kinases and associated factors     100169938 (GSK3B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1 Motif Other DBs NCBI-GeneID:  100169938 NCBI-ProteinID:  NP_001123212 Ensembl:  ENSOARG00000019835 UniProt:  B3FL75 A0A6P9FQG8 LinkDB All DBs Position 1 AA seq 420 aa AA seqDB search MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF NFTTQELSSNPPLATILIPPHARIQAAASTPSNTTAASDANAGDRGQTNNAASASASDSS NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct tcagcttttggcagcatgaaagttagcagagacaaagatggcagcaaggtaaccacagtg gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa gtgattggaaatgggtcatttggtgtggtgtatcaagccaaactttgtgattcaggagaa ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccagatc atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt gaaaagaaagatgaggtctatcttaatctggtgctggactacgttccggaaacagtctac agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg gatattaaaccacagaacctcttgttggatcctgatacagctgtcttgaaactctgtgac tttggaagtgcaaagcagctggtccgtggagaacccaatgtttcgtatatctgttctcgg tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta tggtctgcaggctgtgtgttggctgagctgttgctaggacagccaatatttccaggagac agtggtgtggatcaattggtggaaataatcaaggtcctgggaacaccaacaagggagcaa attagagaaatgaacccaaactacacggaattcaaattccctcaaattaaggcacatcct tggactaaggtcttccgaccccgaactccacccgaggcgattgcactttgtagccgtctg ctggagtatacaccaactgcccgactgacaccactggaagcttgtgcacattcatttttt gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc aacttcaccactcaagaactgtcaagtaatccacctctagctaccatccttattcctcct catgctcggattcaagcagctgcttcaactccttcaaataccacagcagcctcagatgct aatgctggagaccgtggacagaccaataatgccgcttctgcatcagcttccgactcctcc tga

DBGET integrated database retrieval system